KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_10034
Entry
HMPREF0837_10034  CDS       T01259                                 

Definition
(GenBank) putative sugar-specific permease, SgaT/UlaA
  KO
K03475  ascorbate PTS system EIIC component
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
Pathway
snc00053  Ascorbate and aldarate metabolism
snc01100  Metabolic pathways
snc01120  Microbial metabolism in diverse environments
snc02060  Phosphotransferase system (PTS)
Module
snc_M00550  Ascorbate degradation, ascorbate => D-xylulose-5P
Brite
KEGG Orthology (KO) [BR:snc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    HMPREF0837_10034
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    HMPREF0837_10034
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:snc02000]
    HMPREF0837_10034
Transporters [BR:snc02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Ascorbate-specific II component
    HMPREF0837_10034
SSDB
Motif
Pfam: EIIC-GAT Pox_polyA_pol
Other DBs
NCBI-ProteinID: ADI68262
UniProt: D6ZN71
Position
complement(29649..31106)
AA seq 485 aa
MEVVSNVLNWFSSNILQNPAFFVGLLVLIGYALLKKPAHDVFSGFVKATVGYMLLNVGAG
GLVTTFRPILAALNYKFQIGAAVIDPYFGLAAANNKIAAEFPDFVGTATTALLIGFGINI
LLVALRKITKVRTLFITGHIMVQQAATVSLMVLFLVPQLRNAYGTAAIGIICGLYWAVSS
NMTVEATQRLTGGGGFAIGHQQQFAIWFVDKVAGRFGKKEESLDNLKLPKFLSIFHDTVV
ASATLMLVFFGAILLILGPDIMSNKEVITSGTLFNPAKQDFFMYIIQTAFTFSVYLFVLM
QGVRMFVSELTNAFQGISNKLLPGSFPAVDVAASYGFGSPNAVLSGFTFGLIGQLIIIVL
LIVFKNPILIITGFVPVFFDNAAIAVYADKRGGWKAAVILSFISGVLQVALGALCVALLD
LAAYGGYHGNIDFEFPWLGFGYIFKYLGIVGYVLVCLFLLVIPQLQFAKAKDKEKYYNGE
VQEEA
NT seq 1458 nt   +upstreamnt  +downstreamnt
atggaagtcgtttcaaatgttctaaattggttttctagcaatattttgcagaatcccgca
tttttcgtaggtttattggtgttgataggatatgcacttttgaaaaaacctgcccatgac
gttttttcagggtttgttaaagcaacagtagggtatatgttgcttaacgtgggtgctggt
ggtttggttacaacctttcgtccaatcttagcagctcttaactacaaattccaaattggt
gcagcggttatcgacccttactttggacttgctgcagcaaacaacaaaattgcagcagag
tttccagattttgttggaactgcaactacagctctattgattggttttggaataaatatc
ttgctcgtagctcttcgaaagattacgaaggtaagaaccctctttattactggtcacatc
atggtacaacaagctgcaacagtatctcttatggttctattcttagtaccacaattgcgc
aatgcttacggtacagcagcgattggtatcatctgtggactttactgggcagttagttca
aatatgactgttgaggcaactcaacgcttgactggtggtggcggatttgcgattggtcac
caacagcaatttgcaatctggtttgtagataaagtagcaggacgctttggtaagaaagaa
gaaagtttagacaatcttaaattacctaagttcctctcaatcttccacgatacagttgtt
gcatctgctaccttgatgctcgtattcttcggagccattcttttaatcttgggtccagac
attatgtctaataaagaagtcatcacttcaggaactctattcaatcctgctaaacaagat
ttctttatgtacattatccaaacagcctttaccttctcagtttacttgttcgttttgatg
caaggtgtccgaatgttcgtatctgagttgacaaacgccttccaaggtatttcaaacaaa
ttgttgccaggttcattcccagcggttgacgttgcagcttcttatggatttggttctcca
aatgctgtcttgtcaggatttacctttggtttgattggtcaattgattataattgtcttg
ctcatcgtctttaaaaatccgattcttattattacaggatttgtaccagtgttctttgac
aatgcagccattgcggtctacgctgataaacgcggcggatggaaagcggctgttatcctt
tcctttatatcaggtgtccttcaagttgctctaggagctctttgtgtggcccttctcgat
ttggcagcttatggtggctaccatggaaatatcgactttgaattcccatggcttggattt
ggatatatcttcaaataccttggtattgttggttatgtacttgtgtgtctcttcttgctt
gttattcctcaacttcaatttgccaaagcaaaagataaagagaaatattacaacggtgaa
gttcaagaagaagcttag

DBGET integrated database retrieval system