KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_10035
Entry
HMPREF0837_10035  CDS       T01259                                 

Definition
(GenBank) hypothetical protein
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
SSDB
Motif
Pfam: YqhG
Other DBs
NCBI-ProteinID: ADI68263
UniProt: D6ZN72
Position
complement(31235..31858)
AA seq 207 aa
MLNKIRDYLDFAGLQYRNPDKAGAEREKMLAFRHKGQEARKAFTELAKAFQASHPEWQLQ
QTSQWMNQAQRLRPHFWVYLQRDGQVTEPMIALRLYGNPSDFGISLEVSFIERKKDEQTL
GKQAKVLEIPTVKGIYYLTYSNGQSQRWEANEEKRRTLREKVRSQEVRKVLVKVDVPMTE
NSSEEEIVEGLLKSYSKILPYYQVTRG
NT seq 624 nt   +upstreamnt  +downstreamnt
atgttgaataagataagagactatttagactttgctggtttgcagtaccgtaatcctgat
aaagcgggagcagagcgagagaagatgctggcattccgccacaaaggacaagaggctcga
aaggcttttacagaactggccaaagcctttcaagcaagccatccagaatggcaactccaa
cagactagtcagtggatgaatcaggcccagcgtttgagaccacatttttgggtttatcta
cagagagacggacaagtgacagaacctatgatagccttgcgtttgtatggaaatccttct
gattttggtatttccttagaagtcagtttcatcgaacgtaagaaggatgagcaaacactg
ggcaagcaggccaaagttttagaaattccaaccgttaaagggatttattatctaacctac
tctaatggtcaaagtcaacggtgggaggcgaatgaagaaaagcgtcgtactttacgcgag
aaggtgagaagtcaagaagttcgaaaagttttagtgaaggtagatgttcctatgacagaa
aattcgtctgaagaagaaatcgtagaaggcttattgaagtcttattctaaaattcttccc
tattatcaggtgactagaggataa

DBGET integrated database retrieval system