KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_10036
Entry
HMPREF0837_10036  CDS       T01259                                 

Definition
(GenBank) R3H domain protein
  KO
K06346  spoIIIJ-associated protein
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
Brite
KEGG Orthology (KO) [BR:snc00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    HMPREF0837_10036
SSDB
Motif
Pfam: Jag_N R3H KH_4 KH_2 Death_2
Other DBs
NCBI-ProteinID: ADI68264
UniProt: D6ZN73
Position
complement(31909..32895)
AA seq 328 aa
MVVFTGSTVEEAIQKGLKELDIPRMKAHIKVISREKKGFLGLFGKKPAQVDIEAISETTV
VKANQQVVKGVPKKINDLNEPVKTVSEETVDLGHVVDAIKKIEEEGQGISDEVKAEILKH
ERHASTILEETGHIEILNELQIEEAMREEAGADDLETEQDQTESQELEDLGLKVETNFDI
EQVATEVMAYVQTIIDDMDVEATLSNDYNRRSINLQIDTNEPGRIIGYHGKVLKALQLLA
QNYLYNRYSRTFYVTINVNDYVEHRAEVLQTYAQKLATRVLEEGRNHKTDPMSNSERKII
HRIISRMDGVTSYSEGDEPNRYVVVDTE
NT seq 987 nt   +upstreamnt  +downstreamnt
atggtagtatttacaggttcaactgttgaagaagcaatccagaaaggattgaaagaatta
gatattccaagaatgaaggctcatatcaaagtcatttctagggagaaaaaaggctttctt
ggtctatttggtaaaaaaccagcccaagtggatattgaagcgattagtgaaacgactgtt
gtcaaagcaaatcaacaggtagtaaaaggcgttccgaaaaaaatcaatgatttgaacgag
cctgtgaagacggttagtgaagaaaccgttgaccttggtcatgtggttgatgctattaaa
aaaatagaggaagaaggtcaaggtatttctgatgaagtcaaggctgaaatcttaaaacat
gaaagacatgccagcactatcttagaagaaactggtcacattgagattttaaatgaactt
caaatcgaggaagcgatgagggaagaagcaggcgctgatgaccttgaaactgagcaagat
caaactgaaagtcaagaactagaagacttgggcttgaaagttgaaacgaactttgatatt
gaacaagtagctacggaagtaatggcttatgttcaaacgattattgatgacatggatgtt
gaggctacactttcaaatgattataaccgtcgtagcatcaatctacaaattgacaccaac
gaaccaggtcgtattatcggctaccatggtaaagtcttgaaggccttgcaactgttggct
caaaattatctttacaaccgctattccagaaccttctacgttacaatcaatgtcaatgat
tatgtcgaacaccgtgcagaagtcttgcagacctatgcgcaaaaattggcgactcgtgtt
ttggaagaagggcgcaatcataaaacagatccaatgtcaaatagcgaacgcaagattatc
catcgtattatttcacgtatggatggcgtgactagttactctgaaggtgatgagccaaat
cgctatgttgttgtagatacagaataa

DBGET integrated database retrieval system