KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_10037
Entry
HMPREF0837_10037  CDS       T01259                                 

Definition
(GenBank) membrane protein insertase, YidC/Oxa1 family
  KO
K03217  YidC/Oxa1 family membrane protein insertase
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
Pathway
snc02024  Quorum sensing
snc03060  Protein export
snc03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:snc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    HMPREF0837_10037
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    HMPREF0837_10037
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    HMPREF0837_10037
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:snc03029]
    HMPREF0837_10037
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:snc02044]
    HMPREF0837_10037
Mitochondrial biogenesis [BR:snc03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-IV assembly factors
    HMPREF0837_10037
Secretion system [BR:snc02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   HMPREF0837_10037
SSDB
Motif
Pfam: 60KD_IMP
Other DBs
NCBI-ProteinID: ADI68265
UniProt: D6ZN74
Position
complement(32914..33744)
AA seq 276 aa
MGVKKKLKLTSLLGLSLLIMTACATNGVTSDITAESADFWSKLVYFFAEIIRFLSFDISI
GVGIILFTVLIRTVLLPVFQVQMVASRKMQEAQPRIKALREQYPGRDMESRTKLEQEMRK
VFKEMGVRQSDSLWPILIQMPVILALFQALSRVDFLKTGHFLWINLGSVDTTLVLPILAA
VFTFLSTWLSNKALSERNGATTAMMYGIPVLIFIFAVYAPGGVALYWTVSNAYQVLQTYF
LNNPFKIIAEREAVVQAQKDLENRKRKAKKKAQKTK
NT seq 831 nt   +upstreamnt  +downstreamnt
atgggagtgaaaaagaaactaaagttgactagtttgctaggactgtctctgttaatcatg
acagcctgtgcgactaatggggtaactagcgatattacagccgaatcggctgatttttgg
agtaaattggtttacttctttgcggaaatcattcgctttttatcgtttgatattagtatc
ggagtggggattattctctttacggtcttgattcgtacagtcctcttgccagtctttcag
gtgcaaatggtggcttctaggaaaatgcaggaagctcagccacgcattaaggcgcttcga
gaacaatatccaggtcgagatatggaaagcagaaccaaactagagcaggaaatgcgtaaa
gtatttaaagaaatgggtgtcagacagtcagactctctttggccgattttgattcagatg
ccggttattttggccttgttccaagccctatcaagagttgactttttaaagacaggtcat
ttcttatggattaaccttggtagtgtggatacaacccttgttcttccgattttagcagca
gtattcacctttttaagtacttggttgtccaacaaagctttgtctgagcgaaatggcgct
acgactgcgatgatgtatgggattccagtcttgatttttatctttgcagtttatgcgcca
ggtggagtcgccctatactggacagtgtctaatgcttatcaagtcttgcaaacctatttc
ttgaataatccattcaagattatcgcagagcgcgaggccgtagtacaggcacaaaaagat
ttggaaaatagaaaaagaaaagccaagaaaaaggctcagaaaacgaaataa

DBGET integrated database retrieval system