KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_10038
Entry
HMPREF0837_10038  CDS       T01259                                 

Gene name
rnpA
Definition
(GenBank) ribonuclease P protein component
  KO
K03536  ribonuclease P protein component [EC:3.1.26.5]
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
Brite
KEGG Orthology (KO) [BR:snc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:snc03016]
    HMPREF0837_10038 (rnpA)
Enzymes [BR:snc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.5  ribonuclease P
     HMPREF0837_10038 (rnpA)
Transfer RNA biogenesis [BR:snc03016]
 Prokaryotic type
  5'processing factors
   Ribonucrease P
    HMPREF0837_10038 (rnpA)
SSDB
Motif
Pfam: Ribonuclease_P
Other DBs
NCBI-ProteinID: ADI68266
UniProt: D6ZN75
Position
complement(33713..34084)
AA seq 123 aa
MKKNFRVKREKDFKAIFKEGTSFANRKFVVYQLENQKNHFRVGLSVSKKLGNAVTRNQIK
RRIRHIIQNAKGSLVEDVDFVVIARKGVETLGYAEMEKNLLHVLKLSKIYREGNGSEKET
KVD
NT seq 372 nt   +upstreamnt  +downstreamnt
ttgaagaaaaactttcgtgtaaaaagagagaaagattttaaggcgattttcaaggagggg
acaagttttgctaatcgcaaatttgtggtctaccaattagaaaaccagaaaaaccatttt
cgagtaggtctatcagttagcaaaaaactggggaatgccgtcactagaaatcaaattaag
cgacggattcggcatattatccagaatgcaaaagggagtctggtagaagatgtcgacttt
gttgtcattgctcgaaaaggagtcgaaaccttgggatacgcagagatggagaaaaatcta
ctccatgtattaaaattatcaaagatttaccgggaaggaaatgggagtgaaaaagaaact
aaagttgactag

DBGET integrated database retrieval system