KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_10039
Entry
HMPREF0837_10039  CDS       T01259                                 

Definition
(GenBank) hypothetical protein
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
SSDB
Other DBs
NCBI-ProteinID: ADI68267
UniProt: D6ZN76
Position
complement(34101..34232)
AA seq 43 aa
MKLKKYSIQGVGKVIFPASFSDEIVQNLAMIGFFEKYGIIVVI
NT seq 132 nt   +upstreamnt  +downstreamnt
gtgaaactaaaaaaatattcaatacaaggagttgggaaagttatttttccagcttctttt
tctgatgaaattgtccaaaaccttgctatgattggcttttttgaaaaatatggtataata
gtagtaatttaa

DBGET integrated database retrieval system