KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_10040
Entry
HMPREF0837_10040  CDS       T01259                                 

Gene name
ackA
Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
Pathway
snc00430  Taurine and hypotaurine metabolism
snc00620  Pyruvate metabolism
snc00640  Propanoate metabolism
snc00680  Methane metabolism
snc01100  Metabolic pathways
snc01120  Microbial metabolism in diverse environments
snc01200  Carbon metabolism
Module
snc_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:snc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    HMPREF0837_10040 (ackA)
   00640 Propanoate metabolism
    HMPREF0837_10040 (ackA)
  09102 Energy metabolism
   00680 Methane metabolism
    HMPREF0837_10040 (ackA)
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    HMPREF0837_10040 (ackA)
Enzymes [BR:snc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     HMPREF0837_10040 (ackA)
SSDB
Motif
Pfam: Acetate_kinase
Other DBs
NCBI-ProteinID: ADI68268
UniProt: D6ZN77
Position
complement(34233..35423)
AA seq 396 aa
MTKTIAINAGSSSLKWQLYLMPEEKVLAKGLIERIGLKDSISTVKFDGRSEQQILDIENH
TQAVKILLDDLIRFDIIKAYDEITGVGHRVVAGGEYFKESTVVEGDVLEKVEELSLLAPL
HNPANAAGVRAFKELLPDITSVVVFDTSFHTSMPEKAYRYPLPTKYYTENKVRKYGAHGT
SHQFVAGEAAKLLGRPLEDLKLITCHIGNGGSITAVKAGKSVDTSMGFTPLGGIMMGTRT
GDIDPAIIPYLMQYTEDFNTPEDISRVLNRESGLLGVSANSSDMRDIEAAVAEGNHEASL
AYEMYVDRIQKHIGQYLAVLNGADAIVFTAGVGENAESFRRDVISGISWFGCDVDDEKNV
FGVTGDISTEAAKIRVLVIPTDEELVIARDVERLKK
NT seq 1191 nt   +upstreamnt  +downstreamnt
atgacaaaaacaattgcaatcaatgcaggaagttcaagtttgaaatggcaattatactta
atgccagaagaaaaagtattggcgaaaggtttgattgaacgtatcggtttgaaagattca
atttcaactgtaaaatttgacggccgttctgaacaacaaattttggatattgaaaatcat
acacaagccgttaaaattttattggatgacttgattcgtttcgatattatcaaggcttat
gacgagattacaggtgttggacatcgtgttgttgctggtggagaatatttcaaagaatca
acagttgttgagggagatgttttagaaaaagttgaagagttgagtttgttggctcctcta
cacaacccggccaatgcagcaggtgttcgtgccttcaaggaattgttgccagacattacc
agtgtagttgtttttgatacttccttccacacaagtatgccagagaaagcttatcgctac
cctctaccaacaaaatattacacagaaaacaaggttcgtaaatacggtgctcatggtaca
agtcaccagtttgtagcaggagaagctgcaaaactcttgggacgtccattagaagacttg
aagttaattacctgtcatattggtaacggaggctcaattacagctgtgaaagccggcaaa
tctgtagacacttctatggggttcactcctcttggtggtattatgatgggaacgcgtaca
ggggatattgatccagctatcattccttatttaatgcaatatacagaggattttaacaca
ccagaagatatcagtcgtgttcttaaccgtgaatcaggtcttttgggagtttctgctaat
tctagcgatatgcgcgatatagaagcagctgtagcagaagggaatcacgaggctagcttg
gcttatgaaatgtatgttgaccgtatccaaaaacatatcggtcagtaccttgcagtgcta
aatggagcagatgccattgttttcacagcaggtgtcggtgaaaatgcagagagtttccgt
cgtgatgtaatctcagggatttcgtggtttggttgtgatgttgatgatgaaaagaatgtc
tttggcgttacaggagacatctcaacagaggcagctaaaatccgtgtcttggttattcca
acagatgaagaattagtcattgcccgtgacgttgaacgcttgaaaaaataa

DBGET integrated database retrieval system