KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_10041
Entry
HMPREF0837_10041  CDS       T01259                                 

Definition
(GenBank) hypothetical protein
  KO
K00571  site-specific DNA-methyltransferase (adenine-specific) [EC:2.1.1.72]
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
Brite
KEGG Orthology (KO) [BR:snc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:snc02048]
    HMPREF0837_10041
Enzymes [BR:snc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.72  site-specific DNA-methyltransferase (adenine-specific)
     HMPREF0837_10041
Prokaryotic defense system [BR:snc02048]
 Restriction and modification system (R-M system)
  Type II R-M system
   DNA methyltransferases
    HMPREF0837_10041
SSDB
Motif
Pfam: N6_Mtase Methyltransf_31 MTS Methyltransf_25 Methyltransf_32 RrnaAD Methyltransf_16 PCMT
Other DBs
NCBI-ProteinID: ADI68269
UniProt: D6ZN78
Position
complement(35474..36427)
AA seq 317 aa
MDFEKIEQAYTYLLENVQVIQSDLATNFYDALVEQNSIYLDGETELNQVKDNNQALKRLA
LRKEEWLKTYQFLLMKAGQTEPLQANHQFTPDAIALLLVFIVEELFKEEEITILEMGSGM
GILGATFLTSLDKKVDYLGMEMDDLLIDLAASMADVIGLQAGFVQGDAVRPQMLKESDVV
ISDLPVGYYPDDAVASRHQVASSQEHTYAHHLLMEQGLKYLKSDGYAIFLAPSDLLTSPQ
SDLLKEWLKEEASLVAMISLPENLFANAKQSKTIFILQKKNEIAVEPFVYPLASLQDASV
LMKFKENFQKWTQGTEI
NT seq 954 nt   +upstreamnt  +downstreamnt
atggattttgaaaaaattgaacaagcttatacctatttactagagaatgtccaagtcatc
caaagtgatttggcgaccaacttttatgacgccttggtggagcaaaacagcatctatctg
gatggtgaaactgagctaaaccaggtcaaagacaacaatcaggcccttaagcgtttagca
ctacgcaaagaagaatggctcaagacctaccagtttctcttgatgaaggctgggcaaaca
gaacccttgcaggccaatcaccagtttacaccagatgccattgctttgcttttggtgttt
attgtggaagagttgtttaaagaggaggaaattactatcctcgaaatgggttctgggatg
ggaattctaggcgctactttcttgacctcgcttgataaaaaggtggattacttgggaatg
gaaatggatgatttgctgattgatctggcagctagcatggcagatgtaattggtttgcag
gctggctttgtccaaggagatgccgttcgtccacaaatgctcaaagaaagcgatgtggtc
atcagtgacttgcctgttggctattatcctgatgatgccgttgcgtcgcgccatcaagtt
gcttctagccaagaacatacttacgcccatcacttgctcatggaacaagggcttaagtac
ctcaagtcagacggatacgctatttttctagctccgagtgatttgttgaccagtcctcaa
agtgatttgttaaaagaatggctgaaagaagaggcgagtctggttgctatgattagtctg
cctgaaaatctctttgctaatgccaaacaatctaagactatttttatcttacagaagaaa
aatgaaatagcagtagagccttttgtttatccacttgctagcttgcaagatgcaagtgtt
ttaatgaaatttaaagaaaattttcaaaaatggactcaaggtactgaaatataa

DBGET integrated database retrieval system