KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_10042
Entry
HMPREF0837_10042  CDS       T01259                                 

Definition
(GenBank) methyltransferase domain protein
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
SSDB
Motif
Pfam: Methyltransf_31 Methyltransf_25 Methyltransf_11 Methyltransf_23 Methyltransf_12 Ubie_methyltran MTS NodS RrnaAD Methyltransf_2 PrmA GidB Methyltransf_PK Methyltransf_32 TehB Methyltransf_16 PCMT Methyltransf_9 tRNA_U5-meth_tr DUF43 Methyltransf_4 CheR Spermine_synth Bmt2 Methyltransf_18 RE_TaqI DREV Cons_hypoth95
Other DBs
NCBI-ProteinID: ADI68270
UniProt: D6ZN79
Position
complement(36488..37075)
AA seq 195 aa
MKHDFNHKAETFDSPKNIFLANLVCQAVEKQIDILSDKEILDFGGGTGLLALPLAKQAKS
VTLVDISEKMLEQARLKAEQQAIKNIQFLEQDLPKNPLEKEFDCLAVSRVLHHMPDLDAA
LSLFHQHLKEDGKLIIADFTKTEANHHGFDLAELENKLIEHGFSSVNSQILYSAEDLFQG
NYSEFFLIVAQKSLA
NT seq 588 nt   +upstreamnt  +downstreamnt
atgaaacatgattttaaccacaaagcagaaactttcgattcccctaaaaatatcttcctc
gcaaacttggtatgtcaagcagtcgagaaacagattgatattttatcagacaaagaaatt
ttagatttcggtggtggcacgggtctattagccttgcccctagccaagcaggctaagtca
gttactcttgtagacatttctgagaaaatgttggagcaagctcgtttgaaagcggagcag
caagcaatcaagaatatccagtttttggagcaagatttaccgaaaaatcccttggagaaa
gagtttgattgccttgctgttagtcgggttcttcatcatatgcctgatttggatgcggct
ctctcactgtttcatcaacatttgaaggaagatgggaaactcatcattgctgattttacc
aagacagaagctaatcatcatggatttgatttagctgaactggaaaacaagctaattgag
catggtttttcatctgtgaatagtcagattctctatagcgctgaagacctgtttcaagga
aattactcagaattctttttaatagtagcccaaaaatcactcgcctag

DBGET integrated database retrieval system