KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_10043
Entry
HMPREF0837_10043  CDS       T01259                                 

Definition
(GenBank) hypothetical protein
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
SSDB
Motif
Pfam: DUF5104 Collectrin
Other DBs
NCBI-ProteinID: ADI68271
UniProt: D6ZN80
Position
complement(37212..37625)
AA seq 137 aa
MWKKKKVKAGVLLYAVTMAAIFSLLLQFYLNRQVAHYQDYALNKEKLVAFAMAKRTKDKA
EQESGEQVFNLGQVSYQNKKTSLVTTVRTDKSQYEFLFPSVKIKEEKRDKKEEVATDSSE
KAEKKKSEEKPEKKENS
NT seq 414 nt   +upstreamnt  +downstreamnt
gtgtggaaaaagaagaaagttaaggcaggtgttctcctctatgcagtcaccatggcagct
atctttagtcttttgttgcaattttacttgaaccgacaagtcgcccactatcaagactat
gctttgaataaagaaaaattggttgcttttgccatggctaaacgaaccaaggataaagcc
gagcaagaaagtggggaacaggtctttaatctaggtcaggtaagctatcaaaacaagaaa
acaagcttggtgacgactgttcgtacggataagagtcaatatgagtttctgtttccttca
gtcaaaatcaaagaagagaaaagagataaaaaggaagaggtagcgactgattcaagcgaa
aaagcggagaagaaaaaatcagaagagaagcctgaaaagaaagagaattcctag

DBGET integrated database retrieval system