KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_10044
Entry
HMPREF0837_10044  CDS       T01259                                 

Definition
(GenBank) prepilin-type cleavage/methylation N-terminal domain protein
  KO
K02248  competence protein ComGF
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
Brite
KEGG Orthology (KO) [BR:snc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:snc02044]
    HMPREF0837_10044
Secretion system [BR:snc02044]
 Type II secretion system
  Competence-related DNA transformation transporter (DNA-T) core components
   HMPREF0837_10044
SSDB
Motif
Pfam: ComGF N_methyl
Other DBs
NCBI-ProteinID: ADI68272
UniProt: D6ZN81
Position
complement(37603..38064)
AA seq 153 aa
MVQNSCWQSKSHKVKAFTLLESLLALLVISGGLLLFQAMSQLLISEVRYQQQSEQKEWLL
FVDQLEAELDRSQFEKVEGNRFYMKQDGKDIAIGKSKSDDFRKTDASGRGYQPMVYGLKS
AQITEDNQLVHFRFQFQKGLEREFIYRVEKEES
NT seq 462 nt   +upstreamnt  +downstreamnt
atggttcagaacagttgttggcaatcaaagagccataaggtcaaggcttttaccttgtta
gaatccctgcttgccctgctcgtcatcagtggaggcttactcctttttcaagctatgagt
cagctcctcatttcagaagttcgctaccagcaacaaagcgagcaaaaggagtggctcttg
tttgtggatcaacttgaggcagaattagaccgttcgcagttcgaaaaagtggaaggcaat
cgtttctatatgaagcaagatggcaaggacatcgccatcggtaagtcaaagtcagacgat
tttcgtaaaaccgatgctagtggacgggggtatcagcctatggtttatggcctcaaatca
gctcagattacagaggacaatcaactggttcattttcgtttccagtttcaaaaaggctta
gaaagggagttcatctatcgtgtggaaaaagaagaaagttaa

DBGET integrated database retrieval system