KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_10045
Entry
HMPREF0837_10045  CDS       T01259                                 

Definition
(GenBank) hypothetical protein
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
SSDB
Motif
Pfam: PulG N_methyl PAP_PilO
Other DBs
NCBI-ProteinID: ADI68273
UniProt: D6ZN82
Position
complement(38027..38329)
AA seq 100 aa
MEKLNALRKQKIRAVILLEAVVALAIFASIATLLLGQIQKNRQEEAKILQKEEVLRVAKM
ALQTGQNQVNINGVEIQVFSSEKGLEVYHGSEQLLAIKEP
NT seq 303 nt   +upstreamnt  +downstreamnt
atggaaaaattaaacgcattaaggaaacaaaaaattagggcagtgattttactggaagca
gtagtcgctctagctatctttgccagcattgcgaccctccttttgggacaaattcaaaaa
aataggcaagaggaagcaaaaatcttgcaaaaggaagaagtcttgagggtagctaagatg
gccttgcagacaggtcaaaatcaggtaaacataaacggagttgagattcaggtgttttct
agcgaaaagggattggaggtctaccatggttcagaacagttgttggcaatcaaagagcca
taa

DBGET integrated database retrieval system