KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_10047
Entry
HMPREF0837_10047  CDS       T01259                                 

Definition
(GenBank) prepilin-type cleavage/methylation N-terminal domain protein
  KO
K02245  competence protein ComGC
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
Brite
KEGG Orthology (KO) [BR:snc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:snc02044]
    HMPREF0837_10047
Secretion system [BR:snc02044]
 Type II secretion system
  Competence-related DNA transformation transporter (DNA-T) core components
   HMPREF0837_10047
SSDB
Motif
Pfam: N_methyl DUF1980 NusG_II DUF4330 SecD-TM1 Baculo_11_kDa
Other DBs
NCBI-ProteinID: ADI68275
UniProt: D6ZN84
Structure
PDB: 
5NCA

Position
complement(38689..39015)
AA seq 108 aa
MKKMMTFLKKSKVKAFTLVEMLVVLLIISVLFLLFVPNLTKQKEAVNDKGKAAVVKVVES
QAELYSLEKNEDASLSKLQADGRITEEQAKAYKEYHDKNGVANRKVND
NT seq 327 nt   +upstreamnt  +downstreamnt
atgaaaaaaatgatgacattcttgaaaaaatctaaggttaaagcttttacattggtggag
atgttggtggtcttgctgattatcagcgtgcttttcttgctctttgtacctaatctgacc
aagcaaaaagaggcagtcaatgacaaaggaaaagcagctgttgttaaggtggtggaaagc
caggcagaactttatagcttggaaaagaatgaagatgctagcctaagcaagttacaagca
gatgggcgaatcacggaagaacaggctaaagcttataaagaataccatgataaaaatgga
gtagcaaatcgtaaagtcaatgattaa

DBGET integrated database retrieval system