KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_10048
Entry
HMPREF0837_10048  CDS       T01259                                 

Definition
(GenBank) bacterial type II secretion system domain protein F
  KO
K02244  competence protein ComGB
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
Brite
KEGG Orthology (KO) [BR:snc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:snc02044]
    HMPREF0837_10048
Secretion system [BR:snc02044]
 Type II secretion system
  Competence-related DNA transformation transporter (DNA-T) core components
   HMPREF0837_10048
SSDB
Motif
Pfam: T2SSF
Other DBs
NCBI-ProteinID: ADI68276
UniProt: D6ZN85
Position
complement(39017..40033)
AA seq 338 aa
MDISQVFRLRRKKLATAKQKNIITLFNNLFSSGFHLVETISFLDRSALLDKQCVTQMRVG
LSQGKSFSEMMESLGCSSAIVTQLSLAEVHGNLHLSLGKIEEYLDNLAKVKKKLIEVATY
PLILLFFLLLIMLGLRNYLLPQLDSSNIATRIIGNLPQIFLGMVGLVSVLALLALTFYKR
SSKMSVFSILARLPFIGIFVQTYLTAYYAREWGNMISQGMELTQIFQMMQEQGSQLFKEI
GQDLAQTLKNGREFSQTIGTYPFFRKELSLIIEYGEVKSKLGSELEIYAEKTWEAFFTRV
NRTMNLVQPLVFIFVALIIVLLYAAMLMPMYQNMEVNF
NT seq 1017 nt   +upstreamnt  +downstreamnt
atggacatatcacaagtcttcaggctgagacggaaaaaattagctacagctaagcaaaaa
aatatcatcaccctatttaacaatctcttttctagcggttttcatctggtggagaccatc
tcctttttagataggagtgctttgttggacaagcagtgtgtaacccagatgcgtgtgggc
ttgtctcaggggaaatcattctcagaaatgatggaaagtttgggatgttcaagtgctatt
gtcactcagttatccctagctgaagttcatggcaatctccacctgagtttgggaaagata
gaagaatatctggacaatctggccaaggtcaagaaaaaattaattgaagtagcgacctat
cctttgattttgctgttttttcttctcttaattatgctggggctacggaattacctgctc
ccacaactggatagtagcaatattgccacccgaattatcggtaatctgccacaaattttt
ctaggcatggtagggcttgtttccgtgcttgcccttttagcactaactttttataaaaga
agttctaagatgagtgttttttctatcttagcacgccttccctttattggaatctttgtg
cagacctacttgacagcctattatgcacgtgaatgggggaatatgatttcacagggaatg
gagctgacgcagatttttcaaatgatgcaggaacaaggttcccagctctttaaagaaatc
ggtcaagatctggctcaaaccctgaaaaatggccgtgaattttctcagacgataggaacc
tatcctttctttaggaaggaattgagtctcatcatagagtatggggaagttaagtccaag
ctgggtagtgagttggaaatctatgctgaaaaaacttgggaagccttttttacccgagtc
aaccgcaccatgaatttggtgcagccactggtttttatctttgtggcactgattatcgtt
ttactttatgcggcaatgctcatgcccatgtatcaaaatatggaggtaaatttttaa

DBGET integrated database retrieval system