KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_10050
Entry
HMPREF0837_10050  CDS       T01259                                 

Definition
(GenBank) hypothetical protein
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
SSDB
Motif
Pfam: DUF1033
Other DBs
NCBI-ProteinID: ADI68278
UniProt: D6ZN87
Position
complement(40998..41369)
AA seq 123 aa
MNMYRVIEMYGDFEPWWFLEGWEEDIVASRKFDQYYDALKYYKTCWFRLEQESPLYKSRS
DLMTIFWDPEDQRWCDECDEYLQQYHSLALLQDEQVIPDEKLRSGYEKQTSQERNRSCRM
KLK
NT seq 372 nt   +upstreamnt  +downstreamnt
atgaatatgtatcgtgttatagaaatgtacggagattttgaaccgtggtggttcttagaa
ggttgggaagaagatattgtagcaagtagaaaatttgaccagtattatgatgctctcaaa
tactacaaaacttgctggtttagattggaacaagaatcgcctctttataaaagtagaagc
gacttgatgaccattttttgggacccggaagaccaacgctggtgtgatgaatgtgatgag
tatttacaacaataccattctttggctcttttgcaggatgagcaggttatcccagacgaa
aaactacgctcaggctatgaaaaacaaaccagtcaggaaaggaatcgttcttgccgtatg
aaattaaaatag

DBGET integrated database retrieval system