KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_10053
Entry
HMPREF0837_10053  CDS       T01259                                 

Definition
(GenBank) acyltransferase
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
SSDB
Motif
Pfam: Acyl_transf_3
Other DBs
NCBI-ProteinID: ADI68281
UniProt: D6ZN90
Structure
PDB: 
5UFY 5UG1

Position
complement(44039..45856)
AA seq 605 aa
MRIKWFSLIRITGLLLVLLYHFFQTIFPGGFFGVDVFFTFSGFLITALLIEEFSKNHEID
LIGFFRRRFYRIVPPVVLMVLVTMPFTFLVRQDYVAGIGGQIAGVLGFMTNFYELLTGGN
YESQFIPHLFVHNWSLAVEVHYYILWGLAVWFLSKQSRSNGQLRGMVFLLSATAFLISFF
SMFIGSFLVTSYSSVYFSSLTHVYPFFLGSILATIVGVRQTTSLVKQLDKIWDLRKTLLV
FAGGFGFLLILTFFVKFTYLFAYLIGFLLASLAALAMILAARVLHEKTPNVQEPKMISFL
ADTSYAVYLFHWPFYIIFSQLTSNLLAVLLTLICSYGFASLSFYVLEPWIAGKNTPVLQT
LRPLPYIHAILATSTGILVFIVFLVTLLAPQVGAFETDLTVNGLKQAASNIAQTKVMAER
AEADSLGIADGTMLIGDSVALRANTALQTALPGAQINAQVSRTTKTANEIMLNNSQNKFL
PKMVVIATGVNNPENYKEDWDSIVKNLPKGHHMILVTPYEGDKTKETYAIVEKAAAYMRE
LAEKTPYITVADWNQVAKEHPEIWAGTDQVHFGSDTSTIEAGAKLYAETIATALQTAQDK
PVKSK
NT seq 1818 nt   +upstreamnt  +downstreamnt
atgcgcattaaatggttttccttgattaggattacaggtttactactggtactcttgtat
catttctttcagaccatctttcctggaggatttttcggggtagatgtctttttcacattt
tcaggtttcctgattacggctctactcatcgaagaattttctaaaaatcatgagattgac
ttgataggattttttaggagacgcttttatcggattgtgccacctgtggttttgatggtc
ttggtgaccatgccctttacctttctagttcggcaagattatgtggctggaattgggggt
cagattgcgggtgtcttaggctttatgaccaacttctatgaacttctaacaggtgggaat
tatgaatctcagttcattccacatttgtttgttcataattggagcttggctgttgaggtt
cactactatattctatggggattggcagtttggttcttatccaagcagtctagatcaaat
ggtcagttgagagggatggtctttctcttatctgctactgccttcttgattagcttcttc
tccatgtttatcggtagttttctagtgacctcttattcttctgtttatttctccagttta
actcatgtctatccattctttttgggaagtatcctagcaacgattgtaggcgttcgtcag
acgacttccctagttaagcaattggataaaatctgggatttacgcaagacccttttagtt
tttgcaggaggttttggcttcttactcattttgaccttcttcgtcaaatttacctatctc
tttgcctatcttattggcttcttgcttgccagtcttgcagcccttgctatgattctggcg
gcgcgtgtcttacatgaaaagacacctaacgtgcaggagccaaagatgattagcttttta
gcagatactagctatgcagtttatctcttccattggcctttctatatcattttctcacag
ttgacatcaaatcttcttgctgtattactgactctgatttgttcttatggctttgccagt
ctttcattttatgtgttggaaccttggattgcaggaaagaacacacctgttttacaaact
cttcgtcccctgccttatattcacgcaattcttgcaacaagtacaggaatcttggttttc
attgttttcttagtgactttattggcaccacaagtgggagcgtttgagacagacttaact
gtcaatggcttgaagcaagctgctagtaatattgcccaaacaaaagtgatggcagaacga
gcagaagctgatagtttggggattgctgatggtactatgttaattggtgattcagtggct
ttaagggcaaatacagccctgcagacagctcttcctggagcacaaattaacgcgcaggtc
agcagaacaaccaagactgccaatgaaatcatgctaaacaatagccagaataaattttta
cctaagatggtggtcattgcgactggggtaaataatcctgaaaattacaaggaagactgg
gacagtattgtaaaaaatcttcctaagggacaccatatgattttagtcactccttatgag
ggggataagacaaaagagacctatgccatcgttgagaaggctgctgcctatatgagagaa
ttggcagagaagacaccttatatcacagttgctgattggaatcaagttgcgaaagagcat
ccagaaatttgggcaggaacagaccaagtccatttcggaagtgacactagcactattgaa
gcaggagcaaaattgtatgcagagaccattgccacagccttgcaaacagctcaagacaag
ccggttaaatcaaaataa

DBGET integrated database retrieval system