KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_10055
Entry
HMPREF0837_10055  CDS       T01259                                 

Definition
(GenBank) hypothetical protein
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
SSDB
Motif
Pfam: DUF975 Fun_ATP-synt_8
Other DBs
NCBI-ProteinID: ADI68283
UniProt: D6ZN92
Position
47229..48086
AA seq 285 aa
MNYPKIDLKTIRQESKHFQADTPRLFLLYILPSMLVILSSFLNPLSRIHGTVLEQPFFSI
LGQILQAYLFPLLVSFIGTILLTSSVYATLTLMKDSKTEPSVKNSLALFDEERFSQTFLT
LLLKRFYLFLWSIPNLLGIYLLFYSSFLAKKFVTLHPEFPNLDLSSVETERFLMVFGLYF
LASLILIIVGNILYIPQYYAYSQVEFLLCYSLDLGQVPPRRILKTSRSFMKGYKFQHFVL
DLQLLPWYFLNWITFGIASFSLLPYIQCTKIMFYRAVLARKRPKA
NT seq 858 nt   +upstreamnt  +downstreamnt
atgaactatccaaaaattgatttaaaaacaattcgtcaggagtcaaaacattttcaggct
gacaccccccgtctctttctcctctatatccttcccagtatgctggtcatcttatctagt
tttcttaatcccttatctcggatccacgggactgttttagaacagccatttttcagcata
cttggccaaatacttcaagcctacctctttcctctactagtctcctttatcgggactatt
cttttgaccagttccgtctatgcaacactgacactcatgaaagattctaaaacggagcca
tctgtaaaaaacagcctagctctctttgatgaggagcgcttttctcaaacctttttgacc
ctacttctcaaacgtttctatctctttttatggagtatccctaatttacttgggatttat
ctcctcttttatagtagctttttagccaaaaaattcgtcaccctacatcctgagtttcca
aatctagatctctcatcagttgaaaccgagcgtttcctcatggtctttggactctacttt
cttgcaagtctcatcttgatcattgtaggaaatatcctctatattccacagtattatgcc
tattcacaggtggaatttcttctctgttatagtctagacctaggacaggtcccaccaaga
cgaatcctaaaaactagccgttcctttatgaagggctacaagttccagcactttgtccta
gatttacagcttcttccttggtacttcctcaattggattacctttggcattgctagtttt
tcactcctaccttatatccaatgcactaaaattatgttttaccgagcagtattggctcga
aaacgtccaaaagcttga

DBGET integrated database retrieval system