KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_10056
Entry
HMPREF0837_10056  CDS       T01259                                 

Gene name
pcp
Definition
(GenBank) pyroglutamyl-peptidase I
  KO
K01304  pyroglutamyl-peptidase [EC:3.4.19.3]
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
Brite
KEGG Orthology (KO) [BR:snc00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:snc01002]
    HMPREF0837_10056 (pcp)
Enzymes [BR:snc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.3  pyroglutamyl-peptidase I
     HMPREF0837_10056 (pcp)
Peptidases and inhibitors [BR:snc01002]
 Cysteine peptidases
  Family C15: pyroglutamyl peptidase I family
   HMPREF0837_10056 (pcp)
SSDB
Motif
Pfam: Peptidase_C15
Other DBs
NCBI-ProteinID: ADI68284
UniProt: D6ZN93
Position
complement(48114..48758)
AA seq 214 aa
MKVLVTGFEPFGGEKGNPTLEAIKGLPAEIHGAEVRWLEVPTVFHKSAQVLEEEMNRYQP
DFVLCIGQAGGRTSVTPERVAINQDDARISDNEDNQPIDRPIRPDGASAYFSSLPIKAMV
QAIKKEGLPASVSNTAGTFVCSHLMYQALYLVEKKFPYVKAGFMHIPYMMEQVVNRPTTP
TMSLVDIRRGIEAAIGAMIEHGDQELKLVGGETH
NT seq 645 nt   +upstreamnt  +downstreamnt
atgaaagtattagtgacaggttttgagccctttggaggggaaaagggcaatccaactttg
gaggccattaaaggtttaccagctgaaatccatggtgctgaggtccgttggctagaggtg
ccgacagtttttcacaaatctgctcaagtattggaagaagagatgaatcgttatcaacct
gactttgtcctttgtattgggcaagctggtggaagaactagtgtgacacctgaacgagtg
gccattaatcaagacgatgcacgcatttctgataacgaagataatcaaccgattgaccgt
cccattcgcccagatggtgcttcggcctactttagtagtttgccgattaaagcgatggtt
caagctataaaaaaagagggcttaccggcctctgtttccaatacggcagggacttttgtc
tgcagccatttgatgtatcaggctctctatttggtagaaaagaaatttccatatgttaag
gcaggttttatgcatattccttatatgatggaacaggtggtgaacagaccgactactcca
actatgagtttagtggatattcggcgagggatagaagcagcaatcggcgctatgatagaa
catggagatcaggaactcaagttggtaggcggagaaactcattga

DBGET integrated database retrieval system