KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_10057
Entry
HMPREF0837_10057  CDS       T01259                                 

Definition
(GenBank) hypothetical protein
  KO
K08987  putative membrane protein
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
Brite
KEGG Orthology (KO) [BR:snc00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    HMPREF0837_10057
SSDB
Motif
Pfam: DUF1304 DUF3784
Other DBs
NCBI-ProteinID: ADI68285
UniProt: D6ZN94
Position
complement(48833..49234)
AA seq 133 aa
MSIITIILTTIVALEHFYIFYLESIATRSDATSRVFNMEKEELAHPSVSSLFKNQGIYKA
LLGVFLWYGIYFSQNLEIVTIFVLFVIGAATYGSLTADKKIILKQGGSAILALISILLFK
IHLKVDSNLANPF
NT seq 402 nt   +upstreamnt  +downstreamnt
atgtcaattattacaattattttaacaacgatcgttgctttggagcatttttacattttt
tatttggaaagtattgctacgcgatcagatgcgactagtcgtgtatttaatatggaaaag
gaagaattggctcatccgtcagtaagttcattgttcaaaaatcaagggatttataaggct
ctgctaggagtctttctctggtatggcatttatttctcacagaatttagaaattgtgact
atttttgtcttatttgtgattggtgctgcgacttacggctctttaacagcggataaaaaa
attattttgaagcaaggtggatcagctattttggccttgattagtattttactctttaaa
atacacttgaaggtcgattctaatctcgctaatcctttttaa

DBGET integrated database retrieval system