KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_10059
Entry
HMPREF0837_10059  CDS       T01259                                 

Definition
(GenBank) hypothetical protein
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
SSDB
Other DBs
NCBI-ProteinID: ADI68287
UniProt: D6ZN96
Position
complement(49754..49945)
AA seq 63 aa
MASDSRSFFLCHTLRKSLQTTSVLSETSKLCFEQPATSFLVCFLIFIEYQFEWKMESYHL
VMS
NT seq 192 nt   +upstreamnt  +downstreamnt
atggcaagcgattctcgttcgttttttctttgtcatactcttcgaaaatctcttcaaacc
acgtcagttttatctgaaacttcaaagctgtgctttgagcaacctgcgactagcttccta
gtttgctttttgattttcattgagtatcaatttgaatggaaaatggaaagttatcatctt
gtaatgagttaa

DBGET integrated database retrieval system