KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_10060
Entry
HMPREF0837_10060  CDS       T01259                                 

Definition
(GenBank) LysM domain protein
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
SSDB
Motif
Pfam: LysM
Other DBs
NCBI-ProteinID: ADI68288
UniProt: D6ZN97
Position
complement(49993..51135)
AA seq 380 aa
MKKRMLLASTVALSFAPVLATQAEEVLWTARSVEQIQNDLTKTDNKTSYTVQYGDTLSTI
AEALGVDVTVLANLNKITNMDLIFPETVLTTTVNEAEEVTEVEIQTPQADSSEEVTTATA
DLTTNQVIVDDQTVQVADLSQPIAEAPKEVASSSEVTKTVIASEEVAPSTGTSVPEEQTA
ETSSAVAEEAPQETTPAEKQETQASPQAASAVEVTTTSSEAKEVASSNGATAAVSTYQPE
ETKIISTTYEAPAAPDYAGLAVAKSENAGLQPQTAAFKEEIANLFGITSFSGYRPGDSGD
HGKGLAIDFMVPERSELGDKIAEYAIQNMASRGISYIIWKQRFYAPFDSKYGPANTWNPM
PDRGSVTENHYDHVHVSMNG
NT seq 1143 nt   +upstreamnt  +downstreamnt
atgaagaaaagaatgttattagcgtcaacagtagccttgtcatttgccccagtattggca
actcaagcagaagaagttctttggactgcacgtagtgttgagcaaatccaaaacgatttg
actaaaacggacaacaaaacaagttataccgtacagtatggtgataccttgagcactatt
gcagaagccttgggtgtagatgtcacagtgcttgcgaatctgaacaaaatcactaatatg
gacttgattttcccagaaactgttttgacaacgactgtcaatgaagcagaagaagtaaca
gaagttgaaatccaaacacctcaagcagactctagtgaagaagtgacaactgcgacagca
gatttgaccactaatcaagtgatcgttgatgatcaaactgttcaggttgcagacctttct
caaccaattgcagaagctccaaaagaagtagcatcaagttcagaagttacaaagacagtg
attgcttctgaagaagtggcaccatctacgggcacttctgtcccagaggagcaaacggcc
gaaacaagcagtgcagttgcagaagaagctcctcaggaaacgactccagctgagaagcag
gaaacacaagcaagccctcaagctgcatcagcagtggaagtaactacaacaagttcagaa
gcaaaagaagtagcatcatcaaatggagctacagcagcagtttctacttatcaaccagaa
gagacgaaaataatttcaacaacttacgaggctccagctgcgcccgattatgctggactt
gcagtagcaaaatctgaaaatgcaggtcttcaaccacaaacagctgcctttaaagaagaa
attgctaacttgtttggcattacatcctttagtggttatcgtccaggagacagtggagat
cacggaaaaggtttggctatcgactttatggtaccagaacgttcagaattaggggataag
attgcggaatatgctattcaaaatatggccagccgtggcattagttacatcatctggaaa
caacgtttctatgctccattcgatagcaaatatgggccagctaacacttggaacccaatg
ccagaccgtggtagtgtgacagaaaatcactatgatcacgttcacgtttcaatgaatgga
taa

DBGET integrated database retrieval system