KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_10061
Entry
HMPREF0837_10061  CDS       T01259                                 

Definition
(GenBank) HAD hydrolase, family IA, variant 1
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
SSDB
Motif
Pfam: HAD_2 Hydrolase HAD Hydrolase_like PNK3P
Other DBs
NCBI-ProteinID: ADI68289
UniProt: D6ZN98
Structure
PDB: 
2GO7 2MU1 2MU2 2MSN

Position
complement(51301..51921)
AA seq 206 aa
MQKTAFIWDLDGTLLDSYEAILSGIEETFAQFSIPYDKEKVREFIFKYSVQDLLVRVAED
RNLDVEVLNQVRAQSLAEKNAQVVLMPGAREVLAWADESGIQQFIYTHKGNNAFTILKDL
GVESYFTEILTSQSDFVRKPSPEAATYLLDKYQLNSDNTYYIGDRTLDVEFAQNSGIQSI
NFLESTYEGNHRIQALADISRIFETK
NT seq 621 nt   +upstreamnt  +downstreamnt
atgcaaaaaacagcttttatttgggatttagacgggactttattggactcttacgaagcg
attttatcagggattgaggagacttttgctcagttttctattccttatgataaggagaag
gtgagagagtttatcttcaagtattcggtgcaagatttgcttgtgcgggtggcagaagat
agaaatctggatgttgaggtgctaaatcaggtgcgtgcccagagtctggctgagaagaat
gctcaggtagttttgatgccaggtgcgcgtgaggtgctagcttgggcagacgaatcagga
attcagcagtttatatatactcataaggggaacaacgcttttaccattctcaaggacttg
ggggtggaatcctattttacagagattttaaccagtcagagtgactttgtgcggaagcca
agtccagaagcggctacctatctgctagataagtatcagttgaattctgataatacttat
tatataggggatcggactctggatgtggaatttgcccagaatagtgggattcaaagtatc
aactttttagagtctacttatgaagggaatcacaggattcaagcgttagcagatatttcc
cgtatttttgagactaagtga

DBGET integrated database retrieval system