KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_10062
Entry
HMPREF0837_10062  CDS       T01259                                 

Definition
(GenBank) MATE efflux family protein
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
SSDB
Motif
Pfam: MatE MurJ Polysacc_synt_C
Other DBs
NCBI-ProteinID: ADI68290
UniProt: D6ZN99
Position
complement(51925..53205)
AA seq 426 aa
MFKKNKDILNIALPAMGENFLQMLMGMVDSYLVAHLGLIAISGVSVAGNIITIYQAIFIA
LGAAISSVISKSIGQKDQSKLAYHVTEALKITLLLSFLLGFLSIFAGKEMIGLLGTERDV
AESGGLYLSLVGGSIVLLGLMTSLGALIRATHNPRLPLYVSFLSNALNILFSSLAIFVLD
MGIAGVAWGTILSRLVGLVILWSQLKLPYGKPTFGLDKELLTLALPAAGERLMMRAGDVV
IIALVVSFGTEAVAGNAIGEVLTQFNYMPAFGVATATVMLLARAVGEDDWKRVASLSKQT
FWLSLFLMLPLSFSIYVLGVPLTHLYTTDSLAVEASVLVTLFSLLGTPMTTGTVIYTAVW
QGLGNARLPFYATSIGMWCIRIGTGYLLGIVLGWGLPGIWAGSLLDNGFRWLFLRYRYQR
YMSLKG
NT seq 1281 nt   +upstreamnt  +downstreamnt
ttgtttaagaaaaataaagacattcttaatattgcattgccagctatgggtgaaaacttt
ttgcagatgctaatgggaatggtggacagttatttggttgctcatttaggattgatagct
atttcaggggtttcagtagctggtaatattatcaccatttatcaggcgattttcatcgct
ctgggagctgctatttccagtgttatttcaaaaagcatagggcagaaagaccagtcgaag
ttggcctatcatgtgactgaggcgttgaagattaccttactattaagtttccttttagga
tttttgtccatcttcgctgggaaagagatgataggacttttggggacggagagggatgta
gctgagagtggtggactgtatctatctttggtaggcggatcgattgttctcttaggttta
atgactagtctgggagccttgattcgtgcaacgcataatccacgtttgcctctctatgtt
agttttttatccaatgccttgaatattcttttttcaagtctagctatttttgttctggat
atggggatagctggtgttgcttgggggacaattctgtctcgtttggttggtcttgtgatt
ttgtggtcacaattaaaactgccttatgggaagccaacttttggtttagataaggaactg
ttgaccttggctttaccagcagctggagagcgacttatgatgagggctggagatgtagtg
atcattgccttggtcgtttcttttgggacggaggcagttgctgggaatgcaatcggagaa
gtcttgacccagtttaactatatgcctgcctttggcgtcgctacggcaacggtcatgctg
ttggcccgagcagttggagaggatgattggaaaagagtcgctagtttgagtaaacaaacc
ttttggctttctctgttcctcatgttgcccctgtcctttagtatatatgtcttgggtgta
ccattaactcatctctatacgactgattctctagcggtggaggctagtgttctagtgaca
ctgttttcactacttggaacccctatgacgacaggaacagtcatctatacggcagtctgg
cagggattaggaaatgcacgcctccctttttatgcgacaagtataggcatgtggtgtatc
cgcattggaacaggatatctgctggggattgtgcttggttggggcttgcctggtatttgg
gcagggtctctcttggataatggttttcgctggttatttctacgctatcgttaccagcgc
tatatgagcttgaaaggatag

DBGET integrated database retrieval system