KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_10063
Entry
HMPREF0837_10063  CDS       T01259                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
Pathway
snc00260  Glycine, serine and threonine metabolism
snc00750  Vitamin B6 metabolism
snc01100  Metabolic pathways
snc01110  Biosynthesis of secondary metabolites
snc01120  Microbial metabolism in diverse environments
snc01230  Biosynthesis of amino acids
Module
snc_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:snc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HMPREF0837_10063 (thrC)
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    HMPREF0837_10063 (thrC)
Enzymes [BR:snc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     HMPREF0837_10063 (thrC)
SSDB
Motif
Pfam: Thr_synth_N PALP DUF4252
Other DBs
NCBI-ProteinID: ADI68291
UniProt: D6ZNA0
Position
complement(53266..54750)
AA seq 494 aa
MTLVYQSTRDANNTVTASQAILQGLATDGGLFTPVTYPKVDLDFDKLKDTSYQEVAKLVL
SAFLDDFTAEELDYCINNAYDSKFDTPAIAPLVKLDGQYNLELFHGSTIAFKDMALSILP
YFMTTAAKKHGLENKIVILTATSGDTGKAAMAGFADVPGTEIIVFYPKDGVSKIQELQMT
TQTGDNTHVIAIDGNFDDAQTNVKHMFNDVALREKLTTNKLQFSSANSMNIGRLVPQIVY
YVYAYAQLVKTGEIVAGDKINFTVPTGNFGNILAAFYAKQIGLPVGKLICASNDNNVLTD
FFKTRVYDKKREFKVTTSPSMDILVSSNLERLIFHLLGNNAEKTVELMNALNTQGQYKLT
DFDAEILDLFAAEYATEEETAAEIKRVCELDSYIEDPHTAVASAVYKKYQSATGDVTKTV
IASTASPYKFPVVAVEAVTGKAGLTDFEALAQLHEISGVAVPPAVDGLEISPIRHKTTVA
AADMQAAVEAYLGL
NT seq 1485 nt   +upstreamnt  +downstreamnt
atgacattagtttatcaatcaacgcgtgatgccaacaatacagtaactgctagccaagca
attttgcaaggtttggcgacggacggcggtttgtttacaccggttacttatccaaaggta
gatttggactttgacaaattgaaagatacttcttaccaggaagttgctaagctagttttg
tcagcatttttagatgactttacagctgaggagttggactactgtatcaacaatgcctac
gatagcaaatttgatactccagctattgcaccattagtgaaattagatgggcaatacaat
ttggaacttttccatggttcaacgattgcctttaaggatatggccttgtctattttgcca
tactttatgacgactgctgctaagaaacatggtttggagaacaagattgttatcttgaca
gcaacatctggtgacacggggaaagctgctatggcggggtttgcggatgtgcctggtact
gagattatcgtcttttatccaaaggatggtgtcagcaagattcaagagttacaaatgacc
actcaaactggcgacaatactcatgttattgctattgatggtaactttgacgatgcgcaa
acaaatgtgaagcacatgtttaacgacgtggctcttcgtgaaaaattgactaccaacaag
ttgcaattttcatcagctaactctatgaacattggtcgtctggtgccacaaattgtttat
tatgtttatgcttacgctcaattggtcaagactggtgagatcgtggctggtgataagatt
aacttcacagtaccaacaggaaactttggaaatatcttggctgccttttatgccaaacaa
atcggtctcccagttggtaaattgatctgtgcttcaaatgacaacaatgttttgacagac
ttcttcaagacacgtgtttacgacaagaaacgtgagtttaaggtaacaaccagcccatct
atggatatcttggtatcttcaaacttggagcgcttgattttccatcttttgggaaataat
gctgaaaagacagttgaacttatgaatgccttgaacacgcaaggacaatataagttgaca
gactttgatgcagagattttggacctctttgcagctgaatatgcgactgaggaagaaacg
gcagcagagatcaagcgtgtttgtgagttagattcttatatcgaggaccctcatacagct
gttgcttcagcagtttataaaaaataccaatcggccactggagatgtaactaagacagtg
attgcttcaacagctagtccatacaagttcccagtagttgcagtagaagctgtaactgga
aaagcaggtttaacagactttgaagccttggctcaattacatgaaatctcaggcgttgca
gtgccaccagcagttgatgggcttgaaatatctccaattcgtcacaagacaacagtggca
gctgctgacatgcaagcagcggttgaggcttatttaggactttaa

DBGET integrated database retrieval system