KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_10064
Entry
HMPREF0837_10064  CDS       T01259                                 

Definition
(GenBank) hypothetical protein
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
SSDB
Motif
Pfam: GCS2
Other DBs
NCBI-ProteinID: ADI68292
UniProt: D6ZNA1
Position
complement(54826..56103)
AA seq 425 aa
MSCSIDLLKHRYLKNIKENPELFVGIELEYPVASLEGDATDVEVIKDLFHYLVSTLDLTV
AKVDDFGNLIQLVDPISQDAILFEVSYTTIEFAFGKAETIQEVENRFNNYMNVIQRKLAE
SNHAIVGCGIHPNWDKNENCPVAYPRYQMLMDYLNLSRNIIKSDLHHFPEYGTFICGSQV
QLDISKTNYLRVINAFTQIEAAKAYFFANSEFSGADWDTKISRDIFWEESMHGIYPENVG
VNARLLNDEADFFDYLNHSAIFTAERDGQTYYFYPIQAGDYLATPEIQAFALNGDEVIIS
PQEKDFETHRSYQYQDLTTRGTVEFRSVCTQPLDRTFASAAFHLGLLVNLDKLEAYLETA
PFFKVFGYDYKSLRRQFSKKNLTDEEETTIIEFSKDLLLLAEEGLVVRNKEEMTYLQPLR
EELSL
NT seq 1278 nt   +upstreamnt  +downstreamnt
atgtcttgttctatcgatttattaaaacatcggtatttgaaaaatattaaagaaaatcct
gaattgtttgtcggaattgagttggagtatcctgttgcaagtttagaaggggatgctaca
gatgttgaagttataaaggatctatttcattatttagtttctactttggatctcaccgta
gcaaaggtagatgattttggcaatctgatccagttagtagatccgataagtcaggatgct
attttatttgaagtttcctatacaacgattgagtttgcatttggtaaggctgaaacgatt
caagaggtcgaaaatcgtttcaataattatatgaatgtaattcagagaaagttagctgaa
tcaaatcatgctattgttggctgtggtatccatcccaactgggataaaaatgagaattgt
ccagtggcttatccacgctatcagatgttgatggattatttgaatttgagtagaaatatt
attaaatcagatttacatcatttccctgaatatggtacttttatctgtgggagccaggtt
cagctggatatttcaaaaaccaactacttacgggtgattaatgcttttactcaaattgaa
gcggctaaggcttatttctttgcaaactctgaattttcgggtgcggattgggatacgaaa
atttcaagggatattttctgggaagaatctatgcatggtatctatccagagaatgttggg
gtcaatgctagactccttaatgatgaagctgatttttttgactatctaaatcattctgcg
atttttactgcggaacgtgatgggcagacctattatttttatcctattcaggctggggac
tatttggctacgcctgaaatccaagcatttgctctgaatggggatgaggttattatttcc
ccccaagagaaggattttgaaactcatcgtagttaccagtaccaagacttaacgactcga
ggaacagttgagtttcgtagtgtgtgtacacagccacttgataggacttttgcttctgca
gcttttcacttgggattattggttaatttagacaagttagaagcttacttagaaacagca
cctttctttaaagtatttggttatgattacaagtctttaaggagacaattttctaagaaa
aatcttacagatgaggaagaaactacgattattgaattttccaaagacttactcctacta
gctgaggagggactagtggtgagaaataaggaagaaatgacctatttacagcctttgaga
gaagaattgagcctataa

DBGET integrated database retrieval system