KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_10065
Entry
HMPREF0837_10065  CDS       T01259                                 

Definition
(GenBank) hypothetical protein
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
SSDB
Other DBs
NCBI-ProteinID: ADI68293
UniProt: D6ZNA2
Position
62171..62314
AA seq 47 aa
MFSTTTYVVAPCTLVRLVQFSKVFVTCFSQVTTILVYHSRFRLSTLF
NT seq 144 nt   +upstreamnt  +downstreamnt
ttgttcagtactacaacttatgttgtagcgccctgcacattggttcgtcttgttcagttt
tcaaaggtctttgtcacttgcttctctcaagtgacaactatattagtatatcacagccgc
tttcgcttgtcaacacttttttga

DBGET integrated database retrieval system