KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_10066
Entry
HMPREF0837_10066  CDS       T01259                                 

Definition
(GenBank) cytidine/deoxycytidylate deaminase family protein
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
SSDB
Motif
Pfam: dCMP_cyt_deam_1 LmjF365940-deam
Other DBs
NCBI-ProteinID: ADI68294
UniProt: D6ZNA3
Position
complement(62564..62998)
AA seq 144 aa
MDIWEKMYEEAQKLYNPHEVSDFVYANHVVAAVEAEDGQIFTGFCMEGTCGVFHLCAERA
ALFNMYQFSGQTKVKKVLAFRDKPPYGGSSAMPCGACREFLLELNAENKDAEFMMDYNIR
KTVKVAELIPYWWGEERASKFNER
NT seq 435 nt   +upstreamnt  +downstreamnt
atggacatctgggaaaagatgtacgaagaagcacagaaactatacaatccacatgaagta
tcagactttgtttatgccaatcatgttgtagctgcagtagaagcagaagatggacaaata
tttacaggattctgtatggagggaacctgtggtgttttccatctctgcgcagaacgggcg
gccctcttcaatatgtaccaattttcaggacaaactaaggttaagaaagtattagccttt
cgagacaaaccaccttatggtggaagttcagccatgccttgcggtgcttgtagagaattc
cttttagaacttaatgctgaaaataaagatgcagaattcatgatggactataatataaga
aaaacagttaaagtcgcagaactaatcccttattggtggggagaagaacgtgcttctaag
tttaatgagcgatag

DBGET integrated database retrieval system