KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_10068
Entry
HMPREF0837_10068  CDS       T01259                                 

Gene name
pgi
Definition
(GenBank) glucose-6-phosphate isomerase
  KO
K01810  glucose-6-phosphate isomerase [EC:5.3.1.9]
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
Pathway
snc00010  Glycolysis / Gluconeogenesis
snc00030  Pentose phosphate pathway
snc00500  Starch and sucrose metabolism
snc00520  Amino sugar and nucleotide sugar metabolism
snc01100  Metabolic pathways
snc01110  Biosynthesis of secondary metabolites
snc01120  Microbial metabolism in diverse environments
snc01200  Carbon metabolism
Module
snc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
snc_M00909  UDP-N-acetyl-D-glucosamine biosynthesis, prokaryotes, glucose => UDP-GlcNAc
Brite
KEGG Orthology (KO) [BR:snc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF0837_10068 (pgi)
   00030 Pentose phosphate pathway
    HMPREF0837_10068 (pgi)
   00500 Starch and sucrose metabolism
    HMPREF0837_10068 (pgi)
   00520 Amino sugar and nucleotide sugar metabolism
    HMPREF0837_10068 (pgi)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:snc04147]
    HMPREF0837_10068 (pgi)
Enzymes [BR:snc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.9  glucose-6-phosphate isomerase
     HMPREF0837_10068 (pgi)
Exosome [BR:snc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   HMPREF0837_10068 (pgi)
  Exosomal proteins of other body fluids (saliva and urine)
   HMPREF0837_10068 (pgi)
  Exosomal proteins of colorectal cancer cells
   HMPREF0837_10068 (pgi)
SSDB
Motif
Pfam: PGI
Other DBs
NCBI-ProteinID: ADI68296
UniProt: D6ZNA5
Position
complement(64596..65978)
AA seq 460 aa
MIEKKKYWRKNMSHIKFDYSKVLDKFVAPHEVEYMQSQVTAADELIRKGTGAGSDFLGWL
DLPEKYDREEFDRILKAAEQIKSDSDVLVVIGIGGSYLGAKAAIDFLNHHFANLQTKEER
KAPQILYAGNSISSTYLADSVEYVADKDFSVNVISKSGTTTEPAIAFRVFKELLVKKYGQ
EEANKRIYATTDRQKGAVKVEADANGWETFVVPDDIGGRFSVLTAVGLLPIAASGADIKA
LMEGANAARKDYTSDKISENEAYQYAAVRNILYRKGYATEILVNYEPSLQYFSEWWKQLA
GESEGKDQKGIYPTSANFSTDLHSLGQFIQEGTRIMFETVVRVDKPRKNVLIPTLEEDLD
GLGYLQGKDVDFVNKKATDGVLLAHTDGDVPNMYVTLPEQDAFTLGYTIYFFELAIALSG
YLNAINPFDQPGVEAYKRNMFALLGKPGFEELSKELNARL
NT seq 1383 nt   +upstreamnt  +downstreamnt
atgatagaaaagaagaaatattggaggaagaacatgtcacatattaaatttgattattca
aaagttttagacaaatttgttgcaccacatgaagtggaatacatgcaatcacaagtaaca
gcagcagatgaattgatccgtaaaggaactggtgctggtagcgacttcttgggatggttg
gaccttcctgaaaaatacgaccgcgaagaatttgaccgcatcttgaaagctgctgagcaa
atcaagtcagacagcgatgttttggttgtgatcggtattggtggatcttaccttggtgca
aaagcagcaatcgacttcttgaatcaccattttgctaacttgcaaacaaaagaagaacgc
aaagctccacaaatcctttacgcaggaaactcaatctcatctacttaccttgctgactcg
gtagagtatgttgcagacaaagacttctcagtaaacgtaatttctaaatcaggtacaaca
actgaaccagcgattgctttccgtgtctttaaagaactcttggttaagaaatacggtcaa
gaagaagctaacaaacgtatctatgcaacaactgaccgccaaaagggtgctgttaaggtt
gaagcagacgctaacggttgggaaacatttgttgttccagatgatatcggtggacgcttc
tcagtattgacagccgttggtttgcttccaatcgcagcatcaggagctgacatcaaagct
cttatggaaggtgcgaatgcagctcgcaaagactacacttcagacaaaatctctgaaaac
gaagcttaccaatacgcagctgttcgtaacatcctttatcgtaaaggctatgcaactgag
atcttggtaaactatgagccatcacttcaatacttctcagaatggtggaaacaattggct
ggtgaatcagaaggaaaagaccaaaaaggtatctacccaacttcagccaacttctcaact
gacttgcactcacttggtcaatttatccaagaaggaactcgtatcatgtttgaaacagtt
gtccgtgttgacaaacctcgtaaaaacgtgcttattcctactttggaagaagaccttgac
ggacttggttaccttcaaggaaaagacgttgactttgtaaacaaaaaagcaactgacggt
gttcttcttgcccacacagatggtgatgtaccaaacatgtatgtgactcttccagagcaa
gacgctttcactcttggttacactatctacttcttcgaattggcaattgccctttcaggt
tacttgaatgctatcaacccatttgaccaaccaggtgttgaagcttataaacgtaacatg
tttgcccttcttggaaaaccaggatttgaagaattgagcaaagaacttaacgcacgtcta
taa

DBGET integrated database retrieval system