KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_10069
Entry
HMPREF0837_10069  CDS       T01259                                 

Definition
(GenBank) hypothetical protein
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
SSDB
Other DBs
NCBI-ProteinID: ADI68297
UniProt: D6ZNA6
Position
complement(65932..66111)
AA seq 59 aa
MEYLVVLSFIFSKFLECGILRKRLNSDKNWRNSTKKLEKNEGKRYDRKEEILEEEHVTY
NT seq 180 nt   +upstreamnt  +downstreamnt
ttggaatatctggtcgttctttcttttattttttcaaaatttttagaatgtggtatttta
cgcaaacgtttgaattctgataaaaattggagaaattcgacaaaaaaacttgaaaaaaac
gaaggtaagcgttatgatagaaaagaagaaatattggaggaagaacatgtcacatattaa

DBGET integrated database retrieval system