KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_10070
Entry
HMPREF0837_10070  CDS       T01259                                 

Definition
(GenBank) peptidase C26
  KO
K07010  putative glutamine amidotransferase
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
Brite
KEGG Orthology (KO) [BR:snc00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:snc01002]
    HMPREF0837_10070
Peptidases and inhibitors [BR:snc01002]
 Cysteine peptidases
  Family C26: gamma-glutamyl hydrolase family
   HMPREF0837_10070
SSDB
Motif
Pfam: Peptidase_C26 GATase DJ-1_PfpI
Other DBs
NCBI-ProteinID: ADI68298
UniProt: D6ZNA7
Position
complement(66115..66843)
AA seq 242 aa
MIGLSLAFERRGIMARTVVGVTANLCPVDAEGKIIHSSVSCRFAEIIRQVGGLPLVIPVG
DESVVRDYVEMIDKLILTGGQNVHPQFYGEKKTVESDDYNLVRDEFELALLKEALRQNKP
IMAICRGVQLVNVAFGGTLNQEIEGHWQGLPFGTSHSIETVEGSVVAKLFGKESQVNSVH
RQSIKDLAPNFRVTAIDSRDQTIEAIESIDEHRIIGLQWHPEFLVNEEDGNLELFEYLLN
EL
NT seq 729 nt   +upstreamnt  +downstreamnt
atgataggactatcgttagcattcgaaaggagaggcatcatggctagaacggttgtagga
gttactgcaaatctatgtcccgtagacgcagaaggcaaaatcattcattcatctgtatct
tgtagattcgcagagatcattcgtcaagtcggtggtctccctttagtcattcctgttggt
gatgagtcagttgtacgtgattatgtggaaatgattgacaaactcattttgacaggaggc
caaaatgttcatcctcagttttatggagagaaaaagaccgtcgagagcgatgattacaat
ctggtccgtgacgaatttgaattggcactcttgaaggaagcgcttcgtcagaataaacca
attatggcaatctgtcgcggtgtccaacttgtcaatgttgcctttggtggaaccctcaat
caagaaatcgaaggtcactggcaaggactacctttcgggacatctcactctattgagaca
gtagaaggaagcgtggtggctaagctatttgggaaagaaagtcaggtcaattcagtccat
cgtcaaagcattaaagatttggcacccaatttccgtgtaactgctattgattcaagagac
caaactattgaagcgattgagtctatcgacgagcaccgcattatcggtttacagtggcat
ccagagtttctggttaatgaagaagatggcaatttagaattatttgagtatttattgaat
gaactgtaa

DBGET integrated database retrieval system