KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_10071
Entry
HMPREF0837_10071  CDS       T01259                                 

Definition
(GenBank) ABC transporter, ATP-binding protein
  KO
K18892  ATP-binding cassette, subfamily B, multidrug efflux pump
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
Pathway
snc02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:snc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    HMPREF0837_10071
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:snc02000]
    HMPREF0837_10071
Transporters [BR:snc02000]
 ABC transporters, eukaryotic type
  ABCB (MDR/TAP) subfamily
   ABCB-BAC subgroup
    HMPREF0837_10071
SSDB
Motif
Pfam: ABC_membrane ABC_tran SMC_N AAA_21 AAA_22 AAA_23 AAA_30 AAA_29 AAA_16 AAA_15 T2SSE RsgA_GTPase ATPase_2 DEAD AAA_24 Rop-like NB-ARC
Other DBs
NCBI-ProteinID: ADI68299
UniProt: D6ZNA8
Position
complement(66943..68709)
AA seq 588 aa
MKTVQFFWHYFKVYKFSFVVVILMIVLATFAQALFPVFSGQAVTQLANLVQAYQNGNPEL
VWQSLSGIMVNLGLLVLVLFISSVIYMCLMTRVIAESTNEMRKGLFGKLAQLTVSFFDRR
QDGDILSHFTSDLDNILQAFNESLIQVMSNIVLYIGLILVMFSRNVTLALITIASTPLAF
LMLIFIVKMARKYTNLQQKEVGKLNAYMDESISGQKAVIVQGIQEDMMAGFLEQNERVRK
ATFKGRMFSGILFPVMNGMSLINTAIVIFAGSAVLLNDKSIETSTALGLIVMFAQFSQQY
YQPIIQVAASWGSLQLAFTGAERIQEMFDAEEEIRPEKAPTFTKLQESVEISHIDFSYLP
DKPILKDISISAPKGQMTAVVGPTGSGKTTIMNLINRFYDVDAGGIYFDGKDIRGYDLDS
LRSKVGIVLQDSVLFSGTIRDNIRFGVPDASQEMVEVAAKATHIHDYIESLPDKYDTLID
DDQSIFSTGQKQLISIARTLMTDPEVLILDEATSNVDTVTESKIQHAMEVVVAGRTSFVI
AHRLKTILNADQIIVLKDGEVIERGNHHELLKLGGFYSELYHNQFVFE
NT seq 1767 nt   +upstreamnt  +downstreamnt
atgaagacagttcaatttttttggcattattttaaggtctacaagttctcatttgtagtt
gtcatcctgatgattgttctggcgacttttgcccaagccctctttccagtcttttctgga
caagcggtgacgcagctagccaatttagttcaagcttatcaaaatggcaatccagaactt
gtatggcaaagcctatcaggaatcatggtcaatcttggcctgctggttttggttctattt
atctctagtgtaatatacatgtgtctcatgacgcgcgtgattgcagaatcgaccaacgag
atgcgcaaaggcctctttggtaagcttgctcagttgacggtttctttctttgaccgtcga
caagatggcgatatcctgtctcattttaccagtgatttggataatatcctccaagccttt
aacgaaagcttgattcaggtcatgagcaatattgttttatacattggtctgattcttgtc
atgttttcgagaaatgtgacgctggctctcatcaccattgccagcaccccattggctttc
cttatgctgattttcatcgtgaaaatggcacgcaaatacaccaacctccagcagaaagag
gtagggaagctcaacgcctatatggatgagagcatctcaggccaaaaagccgtgattgtg
caaggaattcaagaggatatgatggcaggatttcttgaacaaaatgagcgcgtgcgcaag
gcaacctttaaaggaagaatgttctcaggaattcttttccctgtcatgaatgggatgagc
ctgattaatacagccatcgtcatctttgctggttcggctgtacttttgaatgataagtct
attgaaacaagtacagccctaggtttgattgttatgtttgcacaattttcacagcagtac
taccagcctattatccaagttgcagcgagttggggaagccttcagttggcctttactgga
gctgaacgaattcaggaaatgtttgatgcagaggaggaaatccgacctgaaaaggctcca
accttcactaagttgcaagaaagtgttgaaatcagtcatatcgatttttcatacttgcct
gataaacctattttgaaagatatcagcatttctgcccctaaaggccagatgacagcagtt
gttgggccgacaggttcaggaaaaacgactattatgaacctcatcaatcgcttttatgat
gttgatgctggtggtatttattttgatggtaaagacattcgtggctatgatttagatagt
cttagaagcaaggtgggaattgtattgcaagattcggtcttgtttagcggaacgattcga
gacaatatccgatttggtgtgccagatgctagtcaggaaatggttgaggtagcagcaaaa
gcaacccacattcacgactatatcgaaagtttgcctgataagtacgatactcttattgat
gatgaccagagcatcttttcaacagggcagaagcaattgatttcaatcgctcgaaccctg
atgacagatccagaagttctcattctcgatgaagcaacttcaaacgtagatacggtgaca
gaaagcaagattcagcatgccatggaggtggttgtagcaggtagaactagtttcgtcatt
gcccaccgcttgaaaaccattctcaatgcagatcagattattgtccttaaagatggagaa
gtcattgaacgtggtaaccaccatgaacttttgaagctaggtggcttttattcagaactc
tatcacaatcaatttgttttcgaataa

DBGET integrated database retrieval system