KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_10072
Entry
HMPREF0837_10072  CDS       T01259                                 

Definition
(GenBank) hypothetical protein
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
SSDB
Motif
Pfam: Transposase_20 HHH_3 SpoVT_C
Other DBs
NCBI-ProteinID: ADI68300
UniProt: D6ZNA9
Position
68862..69170
AA seq 102 aa
MSLITHRRFISCNENIKHYKRLIDKAETCVNDLMAEFNSVITTVTGIGDRLGAVILAEIR
NIHAFDNPAQLQAFAGLDSSIYQSDQIDLAGRMVKRSSPHLR
NT seq 309 nt   +upstreamnt  +downstreamnt
atgagtttgataacgcatagacgttttatctcgtgtaatgaaaacatcaaacattacaag
aggctcattgacaaggcggaaacatgtgtcaatgacttgatggctgagttcaactcggtc
atcacgacggttactgggattggggatcgtttaggggcggtcattttagctgagattcga
aatattcatgcctttgataatcctgctcaattacaagctttcgctggactggattcttct
atttatcagtcagatcagattgatttagcaggaagaatggtcaaacggagttcccctcat
ctgcggtag

DBGET integrated database retrieval system