KEGG   Streptococcus pneumoniae TCH8431/19A: HMPREF0837_10461Help
Entry
HMPREF0837_10461  CDS       T01259                                 

Definition
(GenBank) peptidase dimerization domain protein
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
snc  Streptococcus pneumoniae TCH8431/19A
Pathway
snc00300  Lysine biosynthesis
snc01100  Metabolic pathways
snc01120  Microbial metabolism in diverse environments
snc01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:snc00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    HMPREF0837_10461
Enzymes [BR:snc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     HMPREF0837_10461
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28 BMC
Motif
Other DBs
NCBI-ProteinID: ADI68689
UniProt: D6ZQ00
Structure
PDB: 

Position
417481..418854
Genome map
AA seq 457 aa AA seqDB search
MVFPSEQEQIEKFEKDHVAQHYFEVLRTLISKKSVFAQQVGLKEVANYLGEIFKRVGAEV
EIDESYTAPFVMAHFKSSRPDAKTLIFYNHYDTVPADGDQVWTEDPFTLSVRNGFMYGRG
VDDDKGHITARLSALRKYMQHHDDLPVNISFIMEGAEESASTDLDKYLEKHADKLRGADL
LVWEQGTKNALEQLEISGGNKGIVTFDAKVKSADVDIHSSYGGVVESAPWYLLQALQSLR
AADGRILVEGLYEEVQEPNEREMALLETYGQRNPEEVSRIYGLELPLLQEERMAFLKRFF
FDPALNIEGIQSGYQGQGVKTILPAEASAKLEVRLVPGLEPHDVLEKIRKQLDKNGFDKV
ELYYTLGEMSYRSDMSAPAILNVIELAKKFYPQGVSVLPTTAGTGPMHTVFDALEVPMVA
FGLGNANSRDHGGDENVRIADYYTHIELVEELIRSYE
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atggtttttcctagcgaacaagaacagattgaaaaatttgaaaaggatcatgtagcccag
cattattttgaggttttgcgtaccttgatttctaagaaatcagtctttgcccagcaggtt
ggactcaaggaagtcgcaaattatctgggtgagattttcaagcgtgttggagctgaagtg
gagattgatgagagctatacagcgccctttgtcatggcacatttcaagagttcgcgtcca
gatgccaagaccttgattttctataaccactatgacactgtgccagcggatggggatcag
gtctggacagaggatccttttacgctttcggtccgcaatggcttcatgtatgggcgtgga
gttgatgacgacaagggtcatatcacagctcgcttgagtgctttgagaaaatatatgcag
caccatgatgatttacctgtcaatatcagctttatcatggagggagcggaggaatcggct
tcaacagacctagataagtatttggaaaagcatgcagacaaactccgtggggcggatttg
ttggtctgggaacaagggaccaaaaatgccttggaacagctggaaatttctggtggcaat
aaggggattgtgacctttgatgccaaggtaaaaagcgctgatgtggatatccactcgagt
tatggtggtgttgtggaatcagctccttggtatctcctccaagccttacagtctcttcgt
gctgcggatggccgtatcttggttgaaggcttgtacgaagaagtacaagagcccaatgaa
cgagaaatggccttgctagaaacttatggtcaacgaaacccagaggaagttagtcggatt
tatggattggagttgcctctcttacaggaggagcggatggcctttctaaaacgtttcttt
ttcgatccagcgcttaatatcgaaggaatccagtctggttatcaaggtcagggtgttaag
actattttacctgcagaagccagtgccaagctagaggttcgtctggttccgggcctagaa
ccgcatgatgttctggaaaaaattcggaaacagctagacaaaaatggctttgataaggta
gaattatactataccttgggagagatgagctatcgaagcgatatgagcgcaccagccatt
ctcaatgtgatcgagttggccaagaaattctatccacagggcgtttcagtcttgccgacg
acagcggggacaggacctatgcatacggtctttgatgccctagaggtaccaatggttgca
ttcggtctaggaaatgccaatagccgagaccacggtggagatgaaaatgtgcgaatcgct
gattattacacccatatcgaattagtagaggagctgattagaagctatgagtag

DBGET integrated database retrieval system