KEGG   Streptococcus pneumoniae TCH8431/19A: HMPREF0837_11810Help
Entry
HMPREF0837_11810  CDS       T01259                                 

Gene name
tpiA
Definition
(GenBank) triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
snc  Streptococcus pneumoniae TCH8431/19A
Pathway
snc00010  Glycolysis / Gluconeogenesis
snc00051  Fructose and mannose metabolism
snc00562  Inositol phosphate metabolism
snc01100  Metabolic pathways
snc01110  Biosynthesis of secondary metabolites
snc01120  Microbial metabolism in diverse environments
snc01130  Biosynthesis of antibiotics
snc01200  Carbon metabolism
snc01230  Biosynthesis of amino acids
Module
snc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
snc_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:snc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF0837_11810 (tpiA)
   00051 Fructose and mannose metabolism
    HMPREF0837_11810 (tpiA)
   00562 Inositol phosphate metabolism
    HMPREF0837_11810 (tpiA)
Enzymes [BR:snc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     HMPREF0837_11810 (tpiA)
Exosome [BR:snc04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   HMPREF0837_11810 (tpiA)
  Exosomal proteins of bladder cancer cells
   HMPREF0837_11810 (tpiA)
  Exosomal proteins of melanoma cells
   HMPREF0837_11810 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADI70038
UniProt: D6ZMC4
Structure
PDB: 

Position
complement(1666076..1666834)
Genome map
AA seq 252 aa AA seqDB search
MSRKPFIAGNWKMNKNPEEAKAFVEAVASKLPSSDLVEAGIAAPALDLTTVLAVAKGSNL
KVAAQNCYFENAGAFTGETSPQVLKEIGTDYVVIGHSERRDYFHETDEDINKKAKAIFAN
GMLPIICCGESLETYEAGKAAEFVGAQVSAALAGLTAEQVAASVIAYEPIWAIGTGKSAS
QDDAQKMCKVVRDVVAADFGQEVADKVRVQYGGSVKPENVASYMACPDVDGALVGGASLE
AESFLALLDFVK
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgtaaaccatttatcgctggtaactggaaaatgaacaaaaatccagaagaagct
aaagcattcgttgaagcagttgcatcaaaacttccttcatcagatcttgttgaagcaggt
atcgctgctccagctcttgatttgacaactgttcttgctgttgcaaaaggctcaaacctt
aaagttgctgctcaaaactgctactttgaaaatgcaggtgctttcactggtgaaactagc
ccacaagttttgaaagaaatcggtactgactacgttgttatcggtcactcagaacgccgt
gactacttccatgaaactgatgaagatatcaacaaaaaagcaaaagcaatctttgcgaac
ggtatgcttccaatcatctgttgtggtgaatcacttgaaacttacgaagctggtaaagct
gctgaattcgtaggtgctcaagtatctgctgcattggctggattgactgctgaacaagtt
gctgcctcagttatcgcttatgagccaatctgggctatcggtactggtaaatcagcttca
caagacgatgcacaaaaaatgtgtaaagttgttcgtgacgttgtagctgctgactttggt
caagaagtcgcagacaaagttcgtgttcaatacggtggttctgttaaacctgaaaatgtt
gcttcatacatggcttgcccagacgttgacggtgcccttgtaggtggtgcgtcacttgaa
gctgaaagcttcttggctttgcttgactttgtaaaataa

DBGET integrated database retrieval system