KEGG   Streptococcus pneumoniae TCH8431/19A: HMPREF0837_12128Help
Entry
HMPREF0837_12128  CDS       T01259                                 

Definition
(GenBank) alpha-galactosidase
  KO
K07407  alpha-galactosidase [EC:3.2.1.22]
Organism
snc  Streptococcus pneumoniae TCH8431/19A
Pathway
snc00052  Galactose metabolism
snc00561  Glycerolipid metabolism
snc00600  Sphingolipid metabolism
snc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:snc00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    HMPREF0837_12128
  Lipid metabolism
   00561 Glycerolipid metabolism
    HMPREF0837_12128
   00600 Sphingolipid metabolism
    HMPREF0837_12128
Enzymes [BR:snc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     HMPREF0837_12128
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Melibiase Glyco_hydro_36N Glyco_hydro_36C GHL10 Glyco_hydro_31 GHL6 Melibiase_2
Motif
Other DBs
NCBI-ProteinID: ADI70356
UniProt: D6ZNN3
Position
complement(1949334..1951496)
Genome map
AA seq 720 aa AA seqDB search
MGVRIENNLFYVESKNLSLIIENRNGYLLLKHLGKTIKNYKGSNSVYERDHAFSGNPTAT
NRTFSLDTQRQIFGQHGLGDFRKPTIQVQHSVTEVTDFRFVEAKILKGQNGPQGLPSPHS
MDDTETLVLMLEDSKAQLSLTLYYTTFNNDATIASYSKLDNNSNQEVVIHKDFSFMADFP
AADYEIVTLQGAYAREKTVRRQQVEQGIFSISSNRGASGHAQTPALLLCEQGVTEDAGNV
FAIQLMYSGNFEAFVQKNQLNEVRVAIGINPENFSWKLAPEEYFETPVALVTHSDQGLTG
ISHESQNFVLKHIMLSEFSKKERPILINNWEATYFDFQREKLLELADEAKKVGIELFVLD
DGWFGNRFDDNRALGDWVVNEEKLGGSLESLISAIHERGLQFGLWLEPEMISVDSDLYRQ
HPDWAIQVPDYEHTYSRNQLVLNLANPQVVEYLKSVLDQLLSYHEIDYIKWDMNRNITKL
GNGLTYLETQMQSHQYMLGLYELVSYLTEKHSHILFESCSGGGGRNDLGMIRYFPQVWAS
DNTDAIARLPIQYGSSYLYPTISMGAHVSAVPNHQMGRMTPLETRGHVAMMGNLGYELDL
TNLSDEEKATIANQVNLYKELRPVVQLGQQYRLINPDTVSNEAAVQFNYGNQTIVTYVRV
LSVVETMETTLKLKDLDEEGLYKLQENGEVYSGAELMYAGLTVILSQGDFLSRQYIFRKL
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atgggagttaggatagagaataatctattttatgttgagagtaaaaatctaagtttgatt
attgaaaatcgaaatggctacttacttttgaaacatttaggaaagactattaagaactat
aaaggttccaatagtgtttatgaacgagaccatgccttttcaggaaatccaacggctact
aatcgaacctttagtttagatactcagcgacagatttttggacaacatggcttaggagat
tttaggaaaccaaccatacaggttcagcatagtgtaactgaagtaacagactttcgattt
gtagaagcaaagattttaaaaggtcagaatggtccacagggcttaccttctccacatagc
atggacgatacagagactcttgtcttaatgttagaagattctaaggctcaacttagtctg
actttgtattatactacttttaataatgatgcgactattgctagctacagtaaattagat
aataatagtaatcaggaagttgtcatccataaagatttttcttttatggctgattttcca
gctgcagattacgaaatagtaactctgcagggtgcttatgctcgtgaaaagactgttaga
cgtcaacaggtagaacaaggaatcttttcgattagctcaaaccgaggtgcttctggtcat
gctcaaacaccagctcttctactatgcgaacaaggagtcacagaggatgctgggaatgtg
tttgctattcaactaatgtatagtggcaactttgaagcttttgttcaaaaaaatcaattg
aatgaagttcgggtggctattggcattaatccagaaaacttttcttggaagttagcccct
gaggaatactttgaaacaccggtagctttagtgactcattcagatcagggattaactggt
attagtcatgaaagtcagaattttgtactgaagcacattatgctaagtgaattttctaaa
aaagaacgtccaattctaatcaataactgggaagctacttactttgactttcagagagaa
aaactgttagagttagcagatgaagctaagaaagttggcattgaactttttgtattagat
gatggttggtttggcaatcgttttgatgataatcgtgctttaggtgattgggttgttaat
gaggaaaaactgggtggaagtctagaaagtctgatttcagctatccatgaaagaggtttg
cagtttggactttggttagaacccgaaatgatttctgtagatagtgatttgtatcgtcaa
catcctgactgggctattcaggttcctgattatgagcatacttattctcggaatcaatta
gtacttaatcttgccaatcctcaggtagtagaatacttgaaaagtgtcttagatcaactc
ctatcttatcatgagattgattacattaaatgggatatgaaccgcaatatcactaagcta
gggaatggattaacttatctagagacacagatgcaatctcatcagtacatgctggggctt
tacgaactcgtttcttatctgacagagaagcacagccatattctctttgagtcctgctct
ggtggtggtggacgaaatgatcttggtatgatacgctatttcccacaagtctgggctagt
gataatactgatgccattgcacgtttaccaattcaatacggttcatcctatctctatcca
accatttctatgggggctcatgtgtcagcagtaccgaatcatcagatgggacgaatgaca
ccattagaaacacgtggccatgtagcaatgatgggaaatttgggctatgagcttgatttg
acaaatttatcagatgaagagaaagctacgattgctaatcaggtgaacttgtataaagaa
ttacgaccagtagttcagttaggacagcagtatagactaattaatcctgatactgtatcc
aatgaagcagctgtacaatttaattacggaaatcaaacgattgtaacctacgttcgcgtt
ttatctgttgtagagaccatggaaacaactttaaaattaaaagatttggatgaagaggga
ctatataaattacaggaaaatggcgaagtttactcaggtgcagaactaatgtatgcgggc
ttaactgttatcttatcccaaggagattttttgagtagacagtatatttttagaaaacta
tga

DBGET integrated database retrieval system