KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_12197
Entry
HMPREF0837_12197  CDS       T01259                                 

Definition
(GenBank) ribosomal RNA adenine dimethylase family protein
  KO
K00561  23S rRNA (adenine-N6)-dimethyltransferase [EC:2.1.1.184]
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
Brite
KEGG Orthology (KO) [BR:snc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:snc03009]
    HMPREF0837_12197
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:snc01504]
    HMPREF0837_12197
Enzymes [BR:snc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.184  23S rRNA (adenine2085-N6)-dimethyltransferase
     HMPREF0837_12197
Ribosome biogenesis [BR:snc03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    HMPREF0837_12197
Antimicrobial resistance genes [BR:snc01504]
 Gene variants
  Macrolide resistance genes
   23S rRNA methyltransferases
    HMPREF0837_12197
SSDB
Motif
Pfam: RrnaAD Methyltransf_25 NodS MTS PCMT Methyltransf_31 Methyltransf_32 Methyltransf_11 DOT1 TRM13 Methyltransf_23 CMAS Csm1_B
Other DBs
NCBI-ProteinID: ADI70425
UniProt: D6ZP79
Structure
PDB: 
1YUB

Position
2009318..2010055
AA seq 245 aa
MNKNIKYSQNFLTSEKVLNQIIKQLNLKETDTVYEIGTGKGHLTTKLAKISKQVTSIELD
SHLFNLSSEKLKLNTRVTLIHQDILQFQFPNKQRYKIVGNIPYHLSTQIIKKVVFESRAS
DIYLIVEEGFYKRTLDIHRTLGLLLHTQVSIQQLLKLPAECFHPKPKVNSVLIKLTRHTT
DVPDKYWKLYTYFVSKWVNREYRQLFTKNQFHQAMKHAKVNNLSTITYEQVLSIFNSYLL
FNGRK
NT seq 738 nt   +upstreamnt  +downstreamnt
atgaacaaaaatataaaatattctcaaaactttttaacgagtgaaaaagtactcaaccaa
ataataaaacaattgaatttaaaagaaaccgataccgtttacgaaattggaacaggtaaa
gggcatttaacgacgaaactggctaaaataagtaaacaggtaacgtctattgaattagac
agtcatctattcaacttatcgtcagaaaaattaaaactgaatactcgtgtcactttaatt
caccaagatattctacagtttcaattccctaacaaacagaggtataaaattgttgggaat
attccttaccatttaagcacacaaattattaaaaaagtggtttttgaaagccgtgcgtct
gacatctatctgattgttgaagaaggattctacaagcgtaccttggatattcaccgaaca
ctagggttgctcttgcacactcaagtctcgattcagcaattgcttaagctgccagcggaa
tgctttcatcctaaaccaaaagtaaacagtgtcttaataaaacttacccgccataccaca
gatgttccagataaatattggaagctatatacgtactttgtttcaaaatgggtcaatcga
gaatatcgtcaactgtttactaaaaatcagtttcatcaagcaatgaaacacgccaaagta
aacaatttaagtaccattacttatgagcaagtattgtctatttttaatagttatctatta
tttaacgggaggaaataa

DBGET integrated database retrieval system