KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_12198
Entry
HMPREF0837_12198  CDS       T01259                                 

Definition
(GenBank) hypothetical protein
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
SSDB
Other DBs
NCBI-ProteinID: ADI70426
UniProt: D6ZP80
Position
2010060..2010191
AA seq 43 aa
MSRFFKFGKLHVTKGNGDKLLDILLTASKKLKRSLAPTGNLYR
NT seq 132 nt   +upstreamnt  +downstreamnt
atgagtcgcttttttaaatttggaaagttacacgttactaaagggaatggagataaatta
ttagatatactactgacagcttccaagaagctaaagaggtccctagcgcctacggggaat
ttgtatcgataa

DBGET integrated database retrieval system