KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_12199
Entry
HMPREF0837_12199  CDS       T01259                                 

Definition
(GenBank) transposase
  KO
K07485  transposase
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
Brite
KEGG Orthology (KO) [BR:snc00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99976 Replication and repair
    HMPREF0837_12199
SSDB
Motif
Pfam: DDE_Tnp_ISL3 zf-ISL3 HTH_23 HTH_38 HTH_Tnp_ISL3 HTH_11 Sigma70_r4_2 HTH_29 CxC3 GerE
Other DBs
NCBI-ProteinID: ADI70427
UniProt: D6ZP81
Position
complement(2010312..2011559)
AA seq 415 aa
MSHNDSILNILGIKDKNIKIISVEEAEHNNDSVKEYITLITATLSYPINRCRNCGFPTVN
KDGFRKTHVRLASLNGRRYELELRKQRYKCKSCHTTFGAITNLTKENQTLSSDLKNQIML
LARKGLSGQLIAEMCHCSPSSVRRTILERMEPHYRVAKLPKHLCFDEFRSIKSVMSFICC
DAETHQIVTKLQDRLSPTIVDYFESRYSKAERECVQSVVIDLNAQYQSFIYRLFPNANII
IDRFHLVQLAGRALDNCRISILKQLDKQSQEYKIMKSHWKLFHKKAEDLHPEEVVFLRGV
KQYMTRQNAVDLITSKFSKFAEVYQTYQDITKALNERNSELLESTILDYQKTNTEMDTAI
QTLRQNRKYVLNSAKFEYSNGPLEGINRKIKTLKRTCYGFANQKFFFLRIDCIFS
NT seq 1248 nt   +upstreamnt  +downstreamnt
atgtcccataatgattctatcctaaatattcttggaattaaagataaaaatattaaaatt
atttctgttgaagaagctgaacacaacaacgattctgttaaagagtatataacgctaata
acagctactctttcttatccgattaatcgttgtcgtaactgtggctttcccacagttaat
aaggatggctttcgcaaaactcatgtacgactggcaagtttaaatgggagaagatatgaa
ctagagcttcgtaaacaacgctataaatgtaaatcatgccatactacttttggtgctatt
actaatttaaccaaagaaaatcaaaccttatccagtgatctcaaaaatcaaatcatgctt
ttagctcgtaaaggcttatctggtcagcttattgctgaaatgtgtcactgctctcctagc
agtgttcgtcgaacaatcttagagcgcatggaaccacactatcgtgtggctaagttgcct
aagcatctatgttttgacgagtttcgttcaattaagtctgtgatgtcctttatctgttgt
gacgctgaaacccaccaaattgtcacaaagttacaggatcgtctatcacctaccattgtt
gattattttgaaagtcgttattcaaaagccgaacgcgaatgcgttcaatcagttgtaatt
gatttaaatgctcaatatcaaagttttatctatcgccttttccctaatgccaatatcatt
attgatcgcttccaccttgtacaattagctggtcgcgctttggacaattgtcgtatctct
atcctaaagcaacttgataaacagagccaagaatataaaattatgaagtcacattggaag
ctattccataaaaaagctgaagatcttcaccctgaagaagtagtttttcttcgcggcgtt
aaacaatatatgactcgccaaaatgctgttgatctcattactagtaaattttccaagttc
gctgaagtataccaaacttaccaagatatcacgaaagccctaaacgagcgcaatagtgaa
ttactagagtcaaccatcttagactaccaaaaaaccaatacagaaatggatactgctatt
caaacccttcgtcaaaacagaaaatatgtcttaaatagcgctaaatttgaatactctaat
ggtcctttagaaggcatcaatcgcaaaatcaaaaccctaaaacgaacttgttatggtttt
gccaatcaaaaatttttctttttaagaatcgattgtattttttcgtaa

DBGET integrated database retrieval system