KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_12200
Entry
HMPREF0837_12200  CDS       T01259                                 

Definition
(GenBank) hypothetical protein
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
SSDB
Motif
Pfam: TrbC Wzy_C
Other DBs
NCBI-ProteinID: ADI70428
UniProt: D6ZP82
Position
2011739..2011960
AA seq 73 aa
MNFGQNLYNWFLSNAQSLVLLAIVVIGLYLGFKREFSKLIGFLIIAIIAVGLVFNAAGVK
DILLELFNRIIGA
NT seq 222 nt   +upstreamnt  +downstreamnt
atgaattttggacaaaacctttataactggtttctatcaaacgctcaatcactggtgctt
ttagcaatcgttgtgattggcttgtatcttggcttcaagcgtgagtttagcaaactgatt
ggctttttaattattgcgattattgcggttggcttagtcttcaacgctgctggagtaaaa
gacattttactagagctattcaatcgcattattggtgcttaa

DBGET integrated database retrieval system