KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_12201
Entry
HMPREF0837_12201  CDS       T01259                                 

Definition
(GenBank) antirestriction protein ArdA
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
SSDB
Motif
Pfam: ArdA DUF3201 Terpene_synth_C RhoGAP Glyco_trans_1_2
Other DBs
NCBI-ProteinID: ADI70429
UniProt: D6ZP83
Position
2012077..2012574
AA seq 165 aa
MDDMQVYIANLGKYNEGELVGAWFTFPIDFEEVKEKIGLNDEYEEYAIHDYELPFTVDEY
TSIGELNRLWEMVSELPEELQSELSALLTHFSSIEELSEHQEDIIIHSDCDDMYDVARYY
IEETGALGEVPASLQNYIDYQAYGRDLDLSGTFISTNHGIFEIVY
NT seq 498 nt   +upstreamnt  +downstreamnt
atggacgatatgcaagtctatattgcgaatttaggcaaatacaatgagggcgaattggtc
ggtgcgtggtttacctttcccattgactttgaggaagtcaaagagaaaatcggcttgaat
gatgaatatgaggaatacgccattcatgactacgagttaccctttacggttgacgaatac
acttccattggcgaactcaatcgactatgggaaatggtatcggaattacccgaagaatta
caatcggagctatctgctctgctcactcatttttcaagcattgaagaactaagcgaacat
caagaggatattatcattcattccgattgtgatgatatgtatgacgtggcacgctactac
attgaagaaacgggtgctttaggcgaagtaccagctagtcttcaaaactatattgattat
caagcctatggtcgggatttagacctttcaggaacgtttatctcaaccaatcatgggatt
tttgaaatcgtctattaa

DBGET integrated database retrieval system