KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_12202Help
Entry
HMPREF0837_12202  CDS       T01259                                 

Definition
(GenBank) hypothetical protein
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TcpE
Motif
Other DBs
NCBI-ProteinID: ADI70430
UniProt: D6ZP84
Position
2012549..2013055
Genome map
AA seq 168 aa AA seqDB search
MGFLKSSIKSVGTLLLADFLFYGVAQSATPIFYERIDYMKKIRSYTSIWSVEKVLYSIND
FRLPFPITFTQMTWFVVSLFAVMILGNLPPLSMIEGAFLKYFGIPVAFTWFMSTKTFDGK
KPYGFLKSVIAYALRPKLTYAGKKVTLGRNQPQEAITAVRSEFYGISN
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgggatttttgaaatcgtctattaaatctgtcggtacattactactggcagattttcta
ttttacggggtggctcaatcagctacccctattttttatgaaaggattgattacatgaag
aaaatacgaagctataccagtatctggtctgtggaaaaggtactgtattctatcaatgat
tttagacttccgtttcccataacctttacgcaaatgacatggtttgtcgtgtcactcttt
gcagtgatgatacttggcaacttgccccctctttccatgatagagggagcatttctcaaa
tactttgggattcctgtggctttcacatggtttatgtctacaaaaacttttgatggtaaa
aagccttatggatttttgaagtctgtcattgcttatgcactgcgaccaaagctgacctat
gcaggaaaaaaagtaacgcttggcagaaaccagccacaagaagccattacagcagttagg
agtgaattttatggcatatccaattaa

DBGET integrated database retrieval system