KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_12204
Entry
HMPREF0837_12204  CDS       T01259                                 

Definition
(GenBank) hypothetical protein
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
SSDB
Motif
Pfam: TrbL YtxH
Other DBs
NCBI-ProteinID: ADI70432
UniProt: D6ZP86
Position
2015489..2017666
AA seq 725 aa
MKPSIVNRIKSNWTLKRLGKVAMTVAFTLVIAIFLLAMLGTVVQAAGLVDDTVNVANEYS
RYPLENYQLDFYVDNSWGWLPWNWSDGIGKQVMYGLYAITNFIWTISLYVSNATGYLVQE
AYSLDFISATADSIGKNMQTLAGVSANGFSTEGFYVGFLLLLILVLGVYVAYTGLIKRET
TKAIHAIMNFVLVFILSASFIAYAPDYIKKINDFSSDISNASLSLGTKIVMPHSDSQGKD
SVDLIRDSLFSIQVQQPWLLLQYNSSDIESIGIDRVESLLSTSPDSNNGEDREKIVAEEI
EDRSNTNLTITKTINRLGTVFFLFVFNIGISIFVFLLTGIMIFSQVLFIIYAMFLPVSFI
LSMIPSFDGMSKRAITKLFNTILTRAGITLIITTAFSISTMLYTLSAGYPFFLIAFLQIV
TFAGIYFKLGDLMSMFSLQSNDSQSVGSRVMRKPRMLMHAHMHRLQRKLGRSMTTLGAGS
AIVTGKKGQSGSGSSARTQADHSRPDGKEKSTLGKRIGQTIGTVADTKDRMVDTASGLKE
QVKDLPTNARYAVYQGKSKVKENVRDLTSSISQTKAERASGRKEQQEQRRKTIAKRRSEM
EQVKQKKQPASSVHERPTTRQEQYHDEQTSKQSNIQTSYKESQQAKQERPAVKSDFSSPK
VERQGNTVQEKTVQKPATSTTTADRTSQRPITKERPSTVQRVPLQNTRSRPPIKTATIKK
VGKKP
NT seq 2178 nt   +upstreamnt  +downstreamnt
gtgaaaccatcaatagtaaacagaataaaatcaaactggacgctgaaacgtctaggtaaa
gtggcaatgacagtggctttcacacttgtgattgccatttttcttttagccatgctggga
acggtggttcaagctgcgggcttggtagatgatacggtcaatgtggcaaatgaatacagc
cgatacccacttgaaaactatcaactggatttttatgtggataatagctggggctggctt
ccgtggaactggtcggacgggattggaaaacaggtcatgtatggactatatgccattacc
aattttatttggacaatcagtttgtatgtttccaatgcgacaggttacttagtacaggaa
gcctattccttagacttcatttccgctacagcagattccattggtaagaatatgcagacc
ttagctggtgtgagtgcaaacggattttcaacagagggtttctatgttggattcctctta
ctcttgattttggttcttggggtttatgttgcctatacgggactgataaagagagaaacc
acaaaggcaattcatgccattatgaattttgtgctggtgtttatcctatcggcttccttt
attgcctacgctcccgactacattaaaaaaatcaatgacttttcatcagacatcagtaat
gccagtttatcacttggcacgaagattgtcatgccccattccgatagtcaaggcaaggac
agcgtggacttaatcagagatagcctgttttccatacaggttcagcaaccgtggctactg
cttcaatacaacagttcagacattgaaagtatcggtattgaccgtgtggaaagcctgctc
tccaccagcccagattccaacaatggcgaagacagagaaaaaattgttgcggaagaaatt
gaagacagaagcaataccaatctaaccattacaaagaccattaaccgtttaggtacagtc
ttcttcctatttgtcttcaatattgggatttccatatttgtattcctattaacaggaatc
atgattttctcgcaggtactttttatcatctatgctatgtttctgcctgtgagctttatt
ttaagcatgattccatcatttgatggtatgtcaaaacgagccataacaaagctctttaat
accattttgacacgagctggaatcacattgattattacgacagcatttagtatttcaacc
atgctctataccttatcggctggttatccgttctttttgattgcttttctacagattgtg
acctttgcaggaatctacttcaagctgggcgatttaatgagtatgttttctctacagagt
aacgattctcaaagtgtgggaagtcgtgtgatgagaaaacctcgtatgcttatgcacgct
cacatgcaccgtctacagcggaaacttggacgttccatgactactctaggggctgggtct
gccattgttacaggtaaaaaaggacagtcgggttcggggagttctgcaaggacacaagca
gatcactcccgaccagacggaaaggaaaaatcaacacttggaaaacgtatcggtcaaacc
atcggtacagtagctgataccaaagacagaatggtagacactgctagtggtttgaaagaa
caggttaaagatttgccgaccaatgcaagatatgcagtatatcaaggaaaatccaaagta
aaagagaatgtccgtgatttaaccagtagtatttctcaaaccaaagcggaaagagccagt
ggacgcaaggaacagcaggaacaaaggcgaaaaaccattgcgaagcgtcgctctgaaatg
gaacaggtcaaacagaaaaaacagcctgcttcttctgttcatgaaagaccgactacaaga
caagaacaatatcatgatgaacagacctcaaaacagtctaatattcagacttcatataag
gaatctcaacaagccaaacaagagcgtccagcagttaagtccgatttttcaagtccaaaa
gtggaacgccaaggcaataccgttcaagaaaaaaccgttcaaaagccagcaacttcaacc
actacagcagatagaacttcacaacgtccaatcacaaaagaacgtccgtctactgttcaa
agagtaccactacaaaatacaagaagtagaccaccaatcaaaaccgccaccattaagaaa
gtcggtaagaaaccatga

DBGET integrated database retrieval system