KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_12206
Entry
HMPREF0837_12206  CDS       T01259                                 

Definition
(GenBank) hypothetical protein
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
SSDB
Motif
Pfam: TpcC Asp4 NuiA
Other DBs
NCBI-ProteinID: ADI70434
UniProt: D6ZP88
Position
2018661..2019593
AA seq 310 aa
MRKEDLMMKFRKNQNKEKQIPKEKKPRVYKVNPHKKVVIALWVLLGLSFSFAIFKHFTAI
DTHTIHETTIIEKEYVDTHHVENFVENFAKVYYSWEQSDKSIDNRMESLKGYLTDELQAL
NVDTVRKDIPVSSSVRGFQIWTVEPTGDNEFNVTYSVDQLITEGENTKTVHSAYIVSVYV
DGSGNMVLVKNPTITNIPKKSSYKPKAIESEGTVDSITTNEINEFLTTFFKLYPTATASE
LSYYVNDGILKPIGKEYIFQELVNPIHNRKDNQVTVSLTVEYIDQQTKATQVSQFDLVLE
KNGSNWKIIE
NT seq 933 nt   +upstreamnt  +downstreamnt
atgagaaaggaagatttaatgatgaaatttagaaaaaatcagaataaagaaaaacagata
ccaaaggaaaagaaacctcgtgtctataaggtcaatcctcataaaaaggttgtgattgcc
ttgtgggtacttttagggcttagtttcagctttgcgatattcaagcactttacagctata
gatactcatactattcacgaaacaactatcatagaaaaggaatacgttgatactcatcat
gtagaaaattttgtagagaactttgcgaaagtctactattcatgggagcaatccgataag
tccattgataatcgaatggaaagtctaaaaggctatctgacagatgaacttcaagctctc
aatgttgatacagtacgcaaagatattcctgtatcgtcttctgtaagaggatttcagata
tggacggtagagccaactggcgacaatgagtttaatgtaacctacagtgtagaccagctc
attacagagggagaaaatacaaagaccgtccactctgcttatatagtgagtgtctatgta
gatggttctggaaatatggtactggttaagaatccgaccattaccaacatacctaagaaa
tcaagttataaaccaaaagccattgaaagtgaggggacggttgattccattacaaccaat
gaaatcaatgagtttttaacgacgttcttcaagctctatcctacagcgacagccagtgaa
ctttcctactatgtgaatgacgggatattaaaaccaatcggaaaagagtacatctttcaa
gaactggtaaatcctattcacaatcgtaaggataatcaagtcacggtatcgctgacagtg
gagtatatcgaccagcagaccaaagcaacgcaggtatctcaatttgatttggtacttgaa
aagaacgggagtaattggaagattatagaataa

DBGET integrated database retrieval system