KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_12207
Entry
HMPREF0837_12207  CDS       T01259                                 

Definition
(GenBank) putative translation elongation factor G
  KO
K18220  ribosomal protection tetracycline resistance protein
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
Brite
KEGG Orthology (KO) [BR:snc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:snc01504]
    HMPREF0837_12207
Antimicrobial resistance genes [BR:snc01504]
 Gene variants
  Tetracycline resistance genes
   Others
    HMPREF0837_12207
SSDB
Motif
Pfam: GTP_EFTU EFG_IV EFG_C EFG_III MMR_HSR1 GTP_EFTU_D2 RF3_C Cerato-platanin AIG1 FeoB_N
Other DBs
NCBI-ProteinID: ADI70435
UniProt: D6ZP89
Position
2019955..2021889
AA seq 644 aa
MEENHMKIINIGVLAHVDAGKTTLTESLLYNSGAITELGSVDKGTTRTDNTLLERQRGIT
IQTGITSFQWENTKVNIIDTPGHMDFLAEVYRSLSVLDGAILLISAKDGVQAQTRILFHA
LRKMGIPTIFFINKIDQNGIDLSTVYQDIKEKLSAEIVIKQKVELYPNMCVTNFTESEQW
DTVIEGNDDLLEKYMSGKSLEALELEQEESIRFHNCSLFPVYHGSAKNNIGIDNLIEVIT
NKFYSSTHRGQSELCGKVFKIEYSEKRQRLAYIRLYSGVLHLRDSVRISEKEKIKITEMY
TSINGELCKIDKAYSGEIVILQNEFLKLNSVLGDTKLLPQRERIENPLPLLQTTVEPSKP
QQREMLLDALLEISDSDPLLRYYVDSATHEIILSFLGKVQMEVTCALLQEKYHVEIEIKE
PTVIYMERPLKKAEYTIHIEVPPNPFWASIGLSVSPLPLGSGMQYESSVSLGYLNQSFQN
AVMEGIRYGCEQGLYGWNVTDCKICFKYGLYYSPVSTPADFRMLAPIVLEQVLKKAGTEL
LEPYLSFKIYAPQEYLSRAYTDAPKYCANIVDTQLKNNEVILSGEIPARCIQEYRSDLTF
FTNGRSVCLTELKGYHVTTGEPVCQPRRPNSRIDKVRYMFNKIT
NT seq 1935 nt   +upstreamnt  +downstreamnt
atggaggaaaatcacatgaaaattattaatattggagttttagctcatgttgatgcggga
aaaactaccttaacagaaagcttattatataacagtggagcgattacagaattaggaagc
gtggacaaaggtacaacgaggacggataatacgcttttagaacgtcagagaggaattaca
attcagacaggaataacctcttttcagtgggaaaatacgaaggtgaacatcatagacacg
ccaggacatatggatttcttagcagaagtatatcgttcattatcagttttagatggggca
attctactgatttctgcaaaagatggcgtacaagcacaaactcgtatattatttcatgca
cttaggaaaatggggattcccacaatcttttttatcaataagattgaccaaaatggaatt
gatttatcaacggtttatcaggatattaaagagaaactttctgccgaaattgtaatcaaa
cagaaggtagaactgtatcctaatatgtgtgtgacgaactttaccgaatctgaacaatgg
gatacggtaatagagggaaacgatgaccttttagagaaatatatgtccggtaaatcatta
gaagcattggaactcgaacaagaggaaagcataagatttcataattgttccctgttccct
gtttatcacggaagtgcaaaaaacaatatagggattgataaccttatagaagtgattacg
aataaattttattcatcaacacatcgaggtcagtctgaactttgcggaaaagttttcaaa
attgagtattcggaaaaaagacagcgtcttgcatatatacgtctttatagtggcgtactg
catttgcgagattcggttagaatatcggaaaaggaaaaaataaaaattacagaaatgtat
acttcaataaatggtgaattatgtaaaatcgataaggcttattccggggaaattgttatt
ttgcagaatgagtttttgaagttaaatagtgttcttggagatacaaagctattgccacag
agagagagaattgaaaatcccctccctctgctgcaaacaactgttgaaccgagcaaacct
caacaaagggaaatgttacttgatgcacttttagaaatctccgacagtgacccgcttctg
cgatattatgtggattctgcgacacatgaaatcatactttctttcttagggaaagtacaa
atggaagtgacttgtgctctgctgcaagaaaagtatcatgtggagatagaaataaaagag
cctacagtcatttatatggaaagaccgttaaaaaaagcagagtataccattcacatcgaa
gttccaccgaatcctttctgggcttccattggtttatctgtatcaccgcttccgttggga
agtggaatgcagtatgagagctcggtttctcttggatacttaaatcaatcatttcaaaat
gcagttatggaagggatacgctatggctgtgaacaaggattgtatggttggaatgtgacg
gactgtaaaatctgttttaagtatggcttatactatagccctgttagtaccccagcagat
tttcggatgcttgctcctattgtattggaacaagtcttaaaaaaagctggaacagaattg
ttagagccatatcttagttttaaaatttatgcgccacaggaatatctttcacgagcatac
accgatgctcctaaatattgtgcgaacatcgtagacactcaattgaaaaataatgaggtc
attcttagtggagaaatccctgctcggtgtattcaagaatatcgtagtgatttaactttc
tttacaaatggacgtagtgtttgtttaacagagttaaaagggtaccatgttactaccggt
gaacctgtttgccagccccgtcgtccaaatagtcggatagataaagtacgatatatgttc
aataaaataacttag

DBGET integrated database retrieval system