KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_12208
Entry
HMPREF0837_12208  CDS       T01259                                 

Definition
(GenBank) hypothetical protein
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
SSDB
Other DBs
NCBI-ProteinID: ADI70436
UniProt: D6ZP90
Position
2022068..2022256
AA seq 62 aa
MILWNGTVALVLTTVVSIHIGYSRTEMKKSINAQNKIEPANLPKTMVSHVLVLFRKNTPL
VQ
NT seq 189 nt   +upstreamnt  +downstreamnt
atgatactgtggaacggaacagtagccctagtattgactactgtcgtttctattcatatt
ggctattctaggactgagatgaaaaaatctataaatgctcagaataaaattgaacccgca
aatctccccaaaacaatggtgagtcatgtacttgtattattccgaaaaaatacacctctg
gtgcagtga

DBGET integrated database retrieval system