KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_12209
Entry
HMPREF0837_12209  CDS       T01259                                 

Definition
(GenBank) hypothetical protein
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
SSDB
Other DBs
NCBI-ProteinID: ADI70437
UniProt: D6ZP91
Position
2022253..2022498
AA seq 81 aa
MRQIGVSYSGFVDESYTLLSLFDDVEQIEKDNRLQTAIDVVREQFGFLAIQKGTVLTEGS
RNIERSKLIGGHSAGGLEGLK
NT seq 246 nt   +upstreamnt  +downstreamnt
gtgagacaaattggtgtatcttatagtggcttcgtagatgaaagctatactctactatca
ctctttgatgatgtagaacaaattgaaaaagataatagacttcagacagctattgatgtt
gtcagagaacagtttggttttttagccatacaaaaaggaaccgtcctaactgaaggttcc
agaaatattgaacgcagtaaacttatcggtggtcattccgcgggtggattggagggatta
aaatga

DBGET integrated database retrieval system