KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_12210
Entry
HMPREF0837_12210  CDS       T01259                                 

Definition
(GenBank) hypothetical protein
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
SSDB
Motif
Pfam: IMS_C FAS_meander
Other DBs
NCBI-ProteinID: ADI70438
UniProt: D6ZP92
Position
2022495..2022830
AA seq 111 aa
MKQEKNTVQFSEIRSKGCNDIEMLERFLHGIVETATSKLRQRKLKTTEISIRLVHAKSEN
RLPLEFTFSIKPTSSSVIIYTEVINRFKECYTGGGIQGFTIQFDKNTLASA
NT seq 336 nt   +upstreamnt  +downstreamnt
atgaaacaagaaaaaaatacagtacaattttcagaaatccgtagcaaaggatgtaatgat
attgaaatgcttgaaagatttttacatggaatcgttgaaacagcaacttcaaaacttcgt
cagagaaaactcaaaacaactgaaatatcgatacgactagtacatgctaaatctgaaaac
cgattaccattggaatttacatttagcattaagccaacaagctcatctgtgataatctat
actgaggtaatcaatcgctttaaagaatgttacacaggtgggggaattcaaggttttacg
attcaatttgataaaaatacccttgcctctgcatag

DBGET integrated database retrieval system