KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_12211
Entry
HMPREF0837_12211  CDS       T01259                                 

Definition
(GenBank) YolD-like protein
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
SSDB
Motif
Pfam: Spore_coat_CotO
Other DBs
NCBI-ProteinID: ADI70439
UniProt: D6ZP93
Position
2022843..2023211
AA seq 122 aa
MIDRSYLPFQSAREYQDTKMQKWMGFFLSEHASALSDDTNKVTYMSDLSLEKKLLLLSQV
YAGQLRTRIQVIEKNKRVSYTGTIPSLTKDFILIKTTTGHINLKLKDIISIELVEEVLYE
SA
NT seq 369 nt   +upstreamnt  +downstreamnt
atgattgaccgttcatatttaccatttcaatcagcaagagagtaccaggatacaaagatg
caaaaatggatgggctttttcctatctgaacatgcatcagcactctctgatgatacaaac
aaagtaacgtacatgtctgacttatcactagagaagaaattattactcctcagtcaagta
tacgccgggcagctacgcacacgcattcaagtgattgaaaaaaacaagcgtgtttcctac
actggaacaataccaagtctgaccaaagatttcattttgataaaaactacaacaggtcac
atcaatttgaaattaaaagacattattagtattgaacttgtcgaggaggtgctctatgaa
tcagcttga

DBGET integrated database retrieval system