KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_12212
Entry
HMPREF0837_12212  CDS       T01259                                 

Definition
(GenBank) hypothetical protein
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
SSDB
Other DBs
NCBI-ProteinID: ADI70440
UniProt: D6ZP94
Position
2023198..2023497
AA seq 99 aa
MNQLEFQRNHLQMDYYSESYQDFERDFYRYSNMNIPLTFLTDDILKTMATSRKNYFVLNK
EKSRDNRDHFFIFEVSTVDENPLIYHYTYKKTTIYLAEK
NT seq 300 nt   +upstreamnt  +downstreamnt
atgaatcagcttgagtttcagcgtaatcacctacaaatggactattatagcgagagctac
caagattttgaacgtgacttctaccgctactctaacatgaatattccattgaccttccta
actgatgatatcctaaaaacaatggcgacttcacgtaagaattactttgtcctcaataag
gaaaagtccagagataaccgcgatcacttcttcatatttgaagtaagtaccgtagatgag
aatccgctaatctatcattatacatataagaaaactacaatatatttagcagaaaaatag

DBGET integrated database retrieval system