KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_12213
Entry
HMPREF0837_12213  CDS       T01259                                 

Definition
(GenBank) ABC transporter, ATP-binding protein
  KO
K18231  macrolide transport system ATP-binding/permease protein
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
Pathway
snc02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:snc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    HMPREF0837_12213
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:snc02000]
    HMPREF0837_12213
   01504 Antimicrobial resistance genes [BR:snc01504]
    HMPREF0837_12213
Transporters [BR:snc02000]
 ABC transporters, eukaryotic type
  Other subfamilies
   Macrolide exporter
    HMPREF0837_12213
Antimicrobial resistance genes [BR:snc01504]
 Gene variants
  Macrolide resistance genes
   Transporters
    HMPREF0837_12213
SSDB
Motif
Pfam: ABC_tran ABC_tran_Xtn AAA_29 AAA_21 AAA_28 AAA_22 MMR_HSR1 AAA_16 RsgA_GTPase NACHT SMC_N TsaE AAA_14 AAA_33 NTPase_1 AAA_24 cobW MobB NB-ARC MeaB AAA_23 DUF815 AAA_19 Methylase_S ATP-synt_ab MPM1
Other DBs
NCBI-ProteinID: ADI70441
UniProt: D6ZP95
Position
complement(2023615..2025078)
AA seq 487 aa
MELILKAKDIRVEFKGRDVLDINELEVYDYDRIGLVGANGAGKSTLLRVLLGELTPPGCK
MNRLGELAYIPQLDEVTLQEEKDFALVGKLGVEQLNIQTMSGGEETRLKIAQALSAQVHG
ILADEPTSHLDREGIDFLIGQLKYFTGALLVISHDRYFLDEIVDKIWELKDGKITEYWGN
YSDYLRQKEEERKSQAAEYEQFIAERARLERAAEEKRKQARKIEQKAKGSSKKKSTEDGG
RLAHQKSIGSKEKKMYNAAKTLEHRIAALGKVEAPEGIRRIRFRQSKALELHNPYPIVGA
EINKVFGDKALFENASFQIPLGAKVALTGGNGIGKTTLIQMILNHEEGISISPKAKIGYF
AQNGYKYNSNQNVMEFMQKDCDYNISEIRSVLASMGFKQNDIGKSLSVLSGGEIIKLLLA
KMLMGRYNILIMDEPSNFLDIPSLEALEILMKEYTGTIVFITHDKRLLENVADVVYEIRD
KKINLKH
NT seq 1464 nt   +upstreamnt  +downstreamnt
atggaattaatattaaaagcaaaagacattcgtgtggaattcaaaggacgcgatgtttta
gatataaatgaattagaagtatatgattatgaccgtattggtttagtaggagcaaatggt
gctggaaaaagcactttactcagggtacttttaggagaattaactcccccaggatgtaaa
atgaatcgtctgggtgaacttgcctatattccccagttggacgaagtaactctgcaggag
gaaaaagattttgcacttgtaggcaagctaggtgttgagcaattaaatatacagactatg
agcggtggtgaagaaacaaggcttaaaatagcacaggccttatcggcacaggttcatggt
attttagcggatgaacctacgagccatttagaccgtgaaggaattgattttctaatagga
cagctaaaatattttacaggtgcactgttagttattagccatgaccgctattttcttgat
gaaatagtagataaaatatgggaactgaaagatggcaaaatcactgagtattggggaaac
tattctgattatcttcgtcagaaagaggaagaacgtaagagccaagctgcagaatacgaa
caatttattgcggaacgtgcccgattggaaagggctgcggaggaaaagcgaaaacaggct
cgtaaaatagaacagaaggcaaaaggttcttcaaagaaaaaaagtactgaagacggaggg
cgtttagctcatcaaaaatcaataggaagtaaggaaaaaaagatgtataatgctgctaaa
accctagagcacaggattgcggccttaggaaaagtagaagctccggaaggcattcgcaga
attcgtttcaggcaaagtaaagcattggagctccataatccataccctatagtcggtgca
gaaattaataaagtatttggggataaggctctgtttgaaaatgcatcttttcaaattccg
ttaggagcaaaagtggcgttaactggtggtaatggaatcggaaaaacaactttaatccaa
atgatcttaaaccatgaagaaggaatttctatttcgcctaaggcaaaaataggttacttt
gcacagaatggttacaagtacaacagtaatcagaatgttatggagtttatgcagaaggat
tgtgactacaatatatcagaaattcgttcagtgctagcatctatggggttcaaacagaac
gatattggaaaaagtttatctgttttaagcggtggagaaattataaaattgttgcttgct
aaaatgctcatgggtagatataacatcctaataatggatgaacccagtaacttccttgac
ataccaagtttagaggctttggaaatactaatgaaggagtacaccggaactatcgtgttt
atcacccacgataaacgattactcgaaaatgtagcagatgtagtttatgaaattagagat
aagaaaataaatctgaaacattaa

DBGET integrated database retrieval system